Pan troglodytes (chimpanzee): 454678 Help Entry 454678            CDS       T01005                                  Symbol RAB5C Name (RefSeq) ras-related protein Rab-5C   KO K07889   Ras-related protein Rab-5C Organism ptr  Pan troglodytes (chimpanzee) Pathway ptr04014   Ras signaling pathway ptr04137   Mitophagy - animal ptr04144   Endocytosis ptr04145   Phagosome ptr04148   Efferocytosis ptr04962   Vasopressin-regulated water reabsorption ptr05132   Salmonella infection ptr05146   Amoebiasis ptr05152   Tuberculosis Brite KEGG Orthology (KO) [BR:ptr00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     454678 (RAB5C)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     454678 (RAB5C)    04145 Phagosome     454678 (RAB5C)    04137 Mitophagy - animal     454678 (RAB5C)    04148 Efferocytosis     454678 (RAB5C)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     454678 (RAB5C)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     454678 (RAB5C)    05152 Tuberculosis     454678 (RAB5C)   09174 Infectious disease: parasitic    05146 Amoebiasis     454678 (RAB5C)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ptr04131]     454678 (RAB5C)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ptr04147]     454678 (RAB5C)    04031 GTP-binding proteins [BR:ptr04031]     454678 (RAB5C) Membrane trafficking [BR:ptr04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     454678 (RAB5C)  Endosome - Lysosome transport     454678 (RAB5C) Exosome [BR:ptr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    454678 (RAB5C)   Exosomal proteins of other body fluids (saliva and urine)    454678 (RAB5C)   Exosomal proteins of colorectal cancer cells    454678 (RAB5C)   Exosomal proteins of bladder cancer cells    454678 (RAB5C) GTP-binding proteins [BR:ptr04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     454678 (RAB5C) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA MMR_HSR1 RsgA_GTPase AAA_16 Motif Other DBs NCBI-GeneID:  454678 NCBI-ProteinID:  NP_001233312 Ensembl:  ENSPTRG00000009194 VGNC:  14189 UniProt:  G2HJF5 LinkDB All DBs Position 17:14632448..14662338 Genome browser AA seq 216 aa AA seqDB search MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLT QTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQ RQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAK KLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCSN NT seq 651 nt NT seq  +upstreamnt  +downstreamnt atggcgggtcggggaggcgcagcacgacccaatggaccagctgctgggaacaagatctgt caatttaagctggttctgctgggggagtctgcggtaggcaaatccagcctcgtcctccgc tttgtcaagggacagtttcacgagtaccaggagagcacaattggagcggccttcctcaca cagactgtctgcctggatgacacaacggtcaagtttgagatctgggacacagctggacag gagcggtatcacagcctggcccccatgtactatcggggggcccaggctgccatcgtggtc tatgacatcaccaacacagatacatttgcacgggccaagaactgggtgaaggagctacag aggcaggccagccccaacatcgtcattgcactcgcgggtaacaaggcagacctggccagc aagagagccgtggaattccaggaagcacaagcctatgcagacgacaacagtttgctgttc atggagacatcagcaaagactgcaatgaacgtgaacgaaatcttcatggcaatagctaag aagcttcccaagaacgagccccagaatgcaactggtgctccaggccgaaaccgaggtgtg gacctccaggagaacaacccagccagccggagccagtgctgcagcaactga

DBGET integrated database retrieval system