KEGG   Photorhabdus temperata: VY86_19995Help
Entry
VY86_19995        CDS       T03944                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
ptt  Photorhabdus temperata
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ptt00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    VY86_19995
   00650 Butanoate metabolism
    VY86_19995
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    VY86_19995
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VY86_19995
Enzymes [BR:ptt01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     VY86_19995
Amino acid related enzymes [BR:ptt01007]
 Aminotransferase (transaminase)
  Class III
   VY86_19995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(4587410..4588687)
Genome map
AA seq 425 aa AA seqDB search
MTESMLAKRRNAAIAKGVGVTTQVYVERAENAEIWDIQGQRYIDFAAGIAVVNTGHRHPR
VIAAAREQLEQFTHTCHQVVPYENYVALAERLNHLVPGNFAKKTVFVTTGAEAVENAVKI
ARAATGRSGVVAFSGAFHGRTFLGMSLTGKVAPYKMGFGPLVSDVYRVPFPIGLHGISVE
QTLNALENLFKTDIEPTRVAAIIIEPVQGEGGFYPAPPELLKALREIADCHGIVLIADEI
QTGFARTGKLFAMEHYEVVADLTTMAKGLAGGLPLAAVTGRAELMDAVVVGGLGGTYGGN
PVAIAAAHAVLDVIEEEKLNARATQLGDQLKQRLHELRPRVPQIADVRGLGLMIAVEFTR
ANSQEPDASFTNAVRQKALERGLILLMCGVHSNVIRFLPPLTIQNHVFDEALNILESVLL
DLTEQ
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgactgaatctatgttagctaaaagacgcaacgcggctattgcaaaaggcgtgggagtg
accacacaagtctatgtggagcgtgcggaaaacgctgaaatttgggacattcaagggcaa
cgctatatcgattttgctgccggtatcgccgtggtgaataccggccaccgccatccgcgc
gtcatcgcggcagccagagaacaactggaacaatttacccatacctgtcatcaggtagta
ccctacgaaaattatgtggcactggccgaacgtctgaaccatctggttcctggtaatttt
gccaagaagaccgtctttgtcactactggggctgaggcggtggaaaatgccgtgaagatc
gcgcgggccgctaccgggcgcagtggcgtggtagctttcagcggcgctttccatggacgt
accttcctcggtatgtcattaaccggcaaagttgcaccgtacaaaatgggatttggcccg
ctggttagcgacgtttaccgtgttccgtttcctatcgggctgcatggcattagcgtggaa
cagacgctgaatgcgctggaaaatctctttaaaaccgacattgaacccacgcgtgtcgct
gccatcatcatcgaaccggtacagggcgaaggtggtttctatcctgcgcctcctgagttg
ctcaaagccctgcgtgagatcgccgattgtcacggcattgtacttattgccgatgagatc
cagaccggtttcgcgcgtacgggcaaactgtttgccatggagcattatgaggttgttgcc
gatctgaccactatggcgaaaggtctggcgggcggtttgccgctggcggctgtgacggga
cgtgcagagttgatggacgctgtagtggttggtggtctggggggaacctatggtggtaac
ccagtggcgattgcagccgcccatgcggtgctggatgtgatcgaagaagagaagctgaat
gcgcgtgcgacgcagttgggagaccagctaaaacagcgtctgcatgaactgcgaccgcgt
gtcccgcagatcgccgacgtgcgtggacttggactgatgattgcggtggagtttacccgt
gcgaacagtcaggaacccgatgccagctttaccaatgcggtgcgtcagaaagcgctggag
cgtggtctgatcctgctgatgtgcggtgtacacagcaacgtgatccgtttccttccgccg
ctgactatacaaaatcacgtttttgacgaagcactcaatattctggagtctgtgctgctc
gatctgactgaacagtag

DBGET integrated database retrieval system