KEGG   Pandoraea thiooxydans: ABW99_08195Help
Entry
ABW99_08195       CDS       T03947                                 

Definition
(GenBank) fatty acyl-AMP ligase
Organism
ptx  Pandoraea thiooxydans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2579141..2581939
Genome map
AA seq 932 aa AA seqDB search
MNPGNTETQLLATVEALAGELQGSPLAPGSVTLDTHFERDLGLDSLSRAELMNRVEQTCQ
VHLPIDAFAAAMTPADVLRVIATSATHAEPATSGDHPRLVPADEIDAPRDARTLVDVLLW
HAERHPTRTHIVLVEDGVTATAYTYEALHRHAMRIAFGLHRYGIGPGDTVALMLPTCFEY
FISFMGIMLCGAVAVPIYPPTRPSQLEEHVRRHTALLANAGVKALIASPEVVGVARLLRL
NVPTIRQVLTPSAIATEAGGVLVRPRAEDTAFLQYTSGSTGDPKGVVLTHANLLANIRGM
GQRVDIAVTDVLVSWLPLYHDMGLIGAWFAPMYYGLPLVVTSPMTFLARPASWLRLIDQY
RGTMTTAPNFAYERCARRLKDDELRGLDLSSLRFAVCGAEPVSPDTMRAFAARFKPCGFD
ERALTAVYGLAENSVCLTFPLPRRGLRIDRIQRQALALAQQALPAQRDQPAVEIVGCGHP
LPGSELRVVDERGLVLPERHIGRIEFRGTSATSGYYRNPAQTARLIRQGWLDTGDLGYLA
EGELFITGRVKDLIIRGGRHFFPYELEEAVARVPGVLPHGVAVCGDTDPAGGTERMVILA
ETAETDPSRRAQIVAQINDATLKLFETPAEQVSLIPPHSVLKTSSGKIRHAATFELFRRG
GDQLKVRPRWWQLASLARASLGPALRRGWQALVHALYGIYCWAILIMLGLPVWCAVVSRS
DTHRNWRLAGRACRVFLRMIGIRLQTDFSAPTNPAKPPIMVANHASYLDGLILLAALPQP
VNFVAKRELAEQRIAGPFLRAIGTRFVERDDYQGSLQAQALLSTQARHGDTPFFFPEGTF
GRAAGLRTFRLGAFRVACATQRPIVPIALAGVRSILPDGDWVPHRGRAVLTQLAPVMPDG
DDFAAALRLRDAARRAILAHCGEPSASGYGLR
NT seq 2799 nt NT seq  +upstreamnt  +downstreamnt
atgaacccgggcaacaccgagacccagctgctggccacggtcgaagcgcttgccggtgaa
ttgcagggcagcccgctggcgccgggttccgtgacgctggacacccacttcgagcgagac
ctcggcctcgatagcctgtcgcgggccgagttgatgaatcgcgtcgagcagacctgccag
gtacacctgccaatcgatgcattcgccgccgccatgacgccggcggatgtgctgcgcgtc
atcgcaaccagcgcgacgcacgccgaaccagcaaccagcggcgatcacccccggctagtt
cccgccgacgaaatagacgcccccagggatgcccgcacgctggtcgacgtgctgctctgg
catgccgagcgccatcccacgcgcacgcacatcgttctggtcgaagacggtgttacggcc
accgcatacacttacgaagcactccatcggcatgcgatgcgcatcgcattcggcttgcac
cggtatggcatcggtccgggcgacacggtggcgctgatgctgcccacctgcttcgagtat
ttcatttcgttcatgggcatcatgctgtgcggtgccgtggccgtgccgatctacccgccg
acgcggccatcgcagctcgaagagcacgtgcggcggcacaccgccttgctcgccaacgcc
ggcgtcaaggcgctgattgcctcgccggaagtagttggcgtggcgcgcctgttgcgcctt
aacgtaccgacgattcgacaggtattgacaccttcggccatcgccaccgaggcaggcggc
gtgctcgtcaggccacgcgcggaagacaccgcatttctgcaatacacctcgggcagcacc
ggggaccccaagggagtcgtgctgacacacgccaatctgctggccaatattcgcggcatg
gggcagcgcgtcgatatcgccgtgaccgacgtcctggtgagctggttgccgctgtaccac
gacatgggattgatcggcgcctggtttgccccgatgtattacggcttgccgctcgtggtg
acctccccgatgacctttcttgcccgcccagccagttggctgcggctgatcgatcaatac
cgcggcaccatgaccaccgcacccaacttcgcttacgagcgctgcgctcgacgcctcaag
gacgacgagttgcgcggtctcgatttgtcttcgctgcgcttcgcggtttgcggcgccgaa
ccggtcagccccgacaccatgcgcgccttcgccgcacgcttcaagccgtgtggattcgac
gaacgcgcgctgacggccgtctacggtctggccgaaaactcggtgtgcctgacctttccg
ctgcccaggcgcgggttgcgcatcgatcgcatccaacggcaggcgctggcgctcgcgcag
caggcgctgccggcgcagcgtgatcaacccgccgtcgaaatcgtcggctgcgggcaccca
ctgcccggcagcgagttgcgcgtggtcgacgagcgcgggctcgtgctgcccgagcgccat
atcggacgcatcgaatttcgcggcacgtcagccacctccggctactaccgcaaccctgca
caaacggctcgcctgatccggcagggatggctcgataccggcgatctcggctatctggcc
gaaggcgagctgttcatcacaggacgcgtgaaggacctgatcatccgcggcggacgccac
ttctttccctatgaactcgaggaagccgtcgcacgcgtgcccggcgtgctgccgcatggg
gttgccgtatgcggcgacaccgatcccgccggcggcacggaacgcatggtgattttggcg
gaaacggcggaaaccgatccatccaggcgcgcacagatcgtcgcgcagatcaacgatgcc
acgctgaagctattcgagacgccagccgaacaggtatcgctgattcccccgcacagcgtg
ttgaaaacctccagcggcaagatacgtcatgcggcaaccttcgagctgtttcgccgcggc
ggcgaccagttgaaggtgcgcccgcgctggtggcaactggcaagcctggcgcgcgccagc
ctcggtccggcgctgcgccgtggctggcaggcgctcgtgcatgcgctgtatggcatttac
tgctgggcgattctgatcatgctcgggttgccggtatggtgtgcggtggtctcgagatcc
gatacacaccgcaattggcggctcgccgggcgtgcctgccgcgtgtttctgcgcatgatc
gggatacgtctgcagaccgacttcagcgcgccaacgaacccggccaaaccgccaatcatg
gtcgccaaccatgcgagttatctcgacggcctgatactgctcgcggcgctgccgcagccc
gtcaattttgtggcaaaacgtgagctggccgagcaaaggatcgccggcccgttcctgcgc
gccatcggcacccgttttgtcgagcgggacgactatcagggcagcctccaggcgcaggcg
ctgctgagcacccaagcgcgccatggcgacacgccgttctttttcccggaaggcacgttc
ggccgcgccgcggggctgcgcaccttccggctcggcgcatttcgggtcgcctgtgccacg
cagcgcccaatcgtgccgattgcgctggccggcgtgcgctcgatactgcccgacggcgac
tgggtcccccaccgagggcgggccgtgctgacccagttggcgccggtcatgcccgacggt
gacgatttcgccgccgcgctgcgcctgcgcgacgcggcgcgacgcgccattctggcccac
tgcggcgagccgtcggcatccggctatggccttcggtga

DBGET integrated database retrieval system