KEGG   Candidatus Pelagibacter ubique: SAR11_0796Help
Entry
SAR11_0796        CDS       T00257                                 

Gene name
aldH
Definition
(GenBank) aldehyde dehydrogenase (NAD)
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
pub  Candidatus Pelagibacter ubique
Pathway
pub00010  Glycolysis / Gluconeogenesis
pub00053  Ascorbate and aldarate metabolism
pub00071  Fatty acid degradation
pub00280  Valine, leucine and isoleucine degradation
pub00310  Lysine degradation
pub00330  Arginine and proline metabolism
pub00340  Histidine metabolism
pub00380  Tryptophan metabolism
pub00410  beta-Alanine metabolism
pub00561  Glycerolipid metabolism
pub00620  Pyruvate metabolism
pub00625  Chloroalkane and chloroalkene degradation
pub01100  Metabolic pathways
pub01110  Biosynthesis of secondary metabolites
pub01120  Microbial metabolism in diverse environments
pub01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pub00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAR11_0796 (aldH)
   00053 Ascorbate and aldarate metabolism
    SAR11_0796 (aldH)
   00620 Pyruvate metabolism
    SAR11_0796 (aldH)
  Lipid metabolism
   00071 Fatty acid degradation
    SAR11_0796 (aldH)
   00561 Glycerolipid metabolism
    SAR11_0796 (aldH)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAR11_0796 (aldH)
   00310 Lysine degradation
    SAR11_0796 (aldH)
   00330 Arginine and proline metabolism
    SAR11_0796 (aldH)
   00340 Histidine metabolism
    SAR11_0796 (aldH)
   00380 Tryptophan metabolism
    SAR11_0796 (aldH)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SAR11_0796 (aldH)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SAR11_0796 (aldH)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SAR11_0796 (aldH)
Enzymes [BR:pub01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SAR11_0796 (aldH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AAZ21614
UniProt: Q4FMH5
LinkDB All DBs
Position
769202..770683
Genome map
AA seq 493 aa AA seqDB search
MTIDYKKISKNLKFEGRAFIDGKYVDAIDGEKFENINPATGETLCSVSKCNHKDVDLAVK
VSRKAFNSGVWSRTSPEFRKDVLLKFAELLRKTGEENSVLECVDTGKLIGDCINEVANDA
PMHFQWYGELIDKVFGKVGPTEPSLTSLIVKEPIGVVAGVVPWNFPLMMAVWKMAPALAA
GCSVIIKPAEDTPLTAIRVAQIAKEAGIPDGVLNVLPGFGDVGEALGRHDDVDAVSFTGS
TEVGGLFMKYSGESNLKTIGLEMGGKSPFIVLEDAKITDNLIDNAINSAFWNGGQNCSAN
MRQIIHTKVKDEFLDKVSKKVKALKAGDPLDPSSNMGSMISKKHLATVDGYIQKGIDEGA
KLLFGGVSSKDQKGFFAKPTLFDDLKENMTIAQEEIFGPVLGVLTINSDEEALKIASNSK
YGLHASVFTQDIDRAFHMAKSLPCGTVSVNTFSEGDIKTPFGGYRQSGSLSRDQGTEALD
QYLQTKTIWISHS
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgacaatcgactataaaaaaatttctaaaaatctaaaatttgaaggcagagcttttatt
gatggtaaatacgttgatgccattgatggtgaaaaatttgaaaatataaatcctgcaacg
ggtgaaactctttgttcagtttcaaaatgtaatcataaagatgttgatttagcagttaaa
gtttcaagaaaggcttttaatagtggtgtttggtctagaacatctccagaatttagaaaa
gatgtcttactgaaatttgcagaattattaagaaaaactggtgaagaaaattctgttctt
gaatgtgtagatacaggaaaattaattggagactgcattaatgaggttgcaaatgatgcg
ccaatgcattttcagtggtatggagaattaatagataaagtatttggtaaagttggacca
acagaaccatcactaactagtttaattgttaaagaaccaattggtgttgttgctggagtt
gttccttggaatttccctttaatgatggcagtttggaaaatggcaccagcattagctgca
ggatgctctgttataattaaaccagcagaagatacacctttaacagcaattagagttgct
caaattgcaaaagaagcaggtattccagatggagttttaaatgtattacctggctttggt
gatgttggtgaagcacttggtagacatgatgatgttgatgcagtttcatttactggctca
acagaagtaggtggactgttcatgaaatattctggtgaaagtaatttaaagacaattggt
ttagagatgggtggtaaaagtccgttcatcgttttagaagatgcaaagattacagataat
ttaattgataatgcaattaattctgccttttggaatggtggacagaactgctctgcaaat
atgaggcaaataattcacactaaagttaaagatgaatttttagataaagtttccaaaaaa
gtaaaagctcttaaagctggagatccattagatccaagttcaaacatggggtcaatgatt
tctaaaaaacatttagcaacagttgatggttatattcaaaaaggaattgatgaaggtgcc
aaattattatttggaggagtttcaagtaaagatcaaaaaggcttttttgcaaaaccaact
ctatttgatgatttaaaagagaacatgacaattgctcaagaagaaatttttggaccagta
cttggtgttcttacaatcaatagtgacgaagaagctttgaaaattgcaagtaattcaaag
tatggattgcacgcaagtgtttttactcaagatattgatagagcttttcatatggcaaaa
agtttaccttgtggaactgtttcagttaatactttttctgaaggtgatattaaaacacct
tttggtggatacagacagtctggttcattgagtagagatcaaggtacagaagctctggac
caataccttcaaaccaagactatttggattagtcattcataa

DBGET integrated database retrieval system