KEGG   Pelosinus sp. UFO1: UFO1_4735Help
Entry
UFO1_4735         CDS       T03211                                 

Definition
(GenBank) Manganese/iron superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
puf  Pelosinus sp. UFO1
Brite
Enzymes [BR:puf01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     UFO1_4735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
5036871..5037452
Genome map
AA seq 193 aa AA seqDB search
MSYQAQDYSDLLGIQGFSDTLLINHFNLYNGYVKNANEIVAHIENTLAEGQADPIEYAGL
KQRIDQEVAGMRLHELYFENLGGRNEIHLSSSLLKLLKENFGSYEAWEEDFKTTASMQGV
GWAMLCQDNNNGKLNNLWLDEHHSGHPVDRTPLLVLDAWEHSYMLDYGLKRPQYIANFFK
SINWNVVDSRIKI
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgtcatatcaagcgcaggactatagtgatcttttggggattcagggttttagtgacacg
ctcttaataaatcattttaacttatacaatggatatgttaaaaacgcgaatgaaattgta
gcgcatattgaaaacaccttagcagaaggacaggcagaccccatagaatatgcagggctt
aagcaacgaatcgatcaggaagttgctggtatgcgtttgcatgaattgtattttgaaaat
ttgggtggacgaaatgagattcaccttagctcctcattattaaaactattgaaggaaaac
ttcggcagttatgaagcatgggaagaagactttaagactacagctagtatgcaaggcgtt
ggttgggctatgctatgccaagataacaacaatggaaaattaaataatctttggctagat
gaacatcatagcgggcatcctgtagaccgtacccccttattggtgttagatgcttgggaa
cattcttatatgttagactatggtttaaaaagacctcaatatatagcaaattttttcaaa
agtattaattggaatgtagtagatagtagaatcaaaatataa

DBGET integrated database retrieval system