KEGG   Parachlamydia acanthamoebae: PUV_14700Help
Entry
PUV_14700         CDS       T01552                                 

Gene name
sOD
Definition
(GenBank) superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
puv  Parachlamydia acanthamoebae
Brite
Enzymes [BR:puv01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     PUV_14700 (sOD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: CCB86420
UniProt: F8KZR5
LinkDB All DBs
Position
complement(1654880..1655416)
Genome map
AA seq 178 aa AA seqDB search
MRKLLAYGLCLFLLTSCNSSEQKAEDPHHIKKANAVVNPTEGYKTWGNITFTETKEGVQI
VANVQGLPAGKHGFHIHEFGDCSAPDASSAGAHYDPTHHKHGGPDDLDRHVGDLGNLEAN
ENGHALYERLDKTITLNGPNSIVGKSIVIHEDEDDFKSQPAGNSGKRVACGLILPLEE
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagctgttagcttatggattatgcctttttcttttgacatcatgtaattcgtca
gagcaaaaagctgaagatccacatcatattaaaaaagcaaatgcagttgtaaaccccaca
gaaggatataaaacctggggaaatatcacctttacggaaactaaagaaggtgttcaaatt
gtcgcaaatgtgcaaggtctacccgcgggaaagcatgggtttcatatccatgaatttggt
gattgtagtgctccagatgcttcctcggcaggagcacattatgatccgacccaccacaaa
catggtggcccagatgatttggacaggcacgtgggggatcttggcaatttagaggccaat
gaaaatgggcatgctctttatgagcgtttggataaaacaataactctcaatggtccaaac
agcattgtagggaagtcgattgtcattcatgaagatgaagatgactttaaaagtcaaccc
gcaggtaattcaggcaaacgtgttgcttgtgggcttattcttcctcttgaggagtaa

DBGET integrated database retrieval system