KEGG   Proteus vulgaris: AOB99_08970Help
Entry
AOB99_08970       CDS       T04093                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
pvl  Proteus vulgaris
Pathway
pvl00250  Alanine, aspartate and glutamate metabolism
pvl00410  beta-Alanine metabolism
pvl00430  Taurine and hypotaurine metabolism
pvl00650  Butanoate metabolism
pvl01100  Metabolic pathways
pvl01110  Biosynthesis of secondary metabolites
pvl01120  Microbial metabolism in diverse environments
pvl02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:pvl00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    AOB99_08970
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AOB99_08970
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AOB99_08970
   00430 Taurine and hypotaurine metabolism
    AOB99_08970
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    AOB99_08970
Enzymes [BR:pvl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     AOB99_08970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: ALE25501
LinkDB All DBs
Position
complement(1961756..1963147)
Genome map
AA seq 463 aa AA seqDB search
MNKKTPSYSSLDDVYASVDLSQSLPKTHFPQQESHPRHVFDAVRDELMLDGNSRQNLATF
CQTWVDDEIRDLMNLSIDKNMIDKDEYPQTAEIENRCVHMLADLWHSPDPLNTLGCSTIG
SSEAAMLGGLALKWQWRKKRLAAGKATDKPNLICGPVQVCWHKFARYFDVELREIPLEGD
RLMMSPEEVIKRVDENTIGVVPTLGVTFTCTYEPVKAVHDALDQLQKETGLDIPIHVDGA
SGGFLAPFCAPDLEWDFRLPRVKSINSSGHKFGLAPLGSGWVVWREAKDLPEELIFNVNY
LGGNMPTFALNFSRPGGQIIAQYYNFLRLGREGYAKIHNACYHTAQYLAREIEKLGPFEM
IFSGDSQKGIPALAWKLKKEAKVSYSLYDIADKLRSRGWQVPAYSMPADRQDLVIQRILV
RHGVSLDLATLLIEDMKRTLDYFEKHPVSTPLSEEDGGGFNHS
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaaaacgccaagttatagttcactcgatgatgtttatgcatcggttgattta
tcacaatccttaccgaaaacacattttccgcaacaagagagccatcctcgtcatgttttt
gatgctgtaagggatgagctgatgctagatggcaattcaagacaaaatctggccacattt
tgtcaaacctgggtagatgatgagatccgtgatttgatgaatttatctatcgataaaaac
atgatagataaagatgaatatccacaaacggccgaaattgaaaaccgttgtgttcatatg
cttgctgatttatggcactcacccgatccactcaataccctaggttgttcaaccattggc
tcctctgaagcggcaatgctggggggacttgcattaaaatggcaatggcgtaaaaaacgt
cttgctgctggaaaagcgacagataaacctaatcttatttgtgggccagttcaagtctgt
tggcataaatttgcccgttattttgacgttgaactcagagagatcccgcttgaaggtgat
cgcttgatgatgagtcctgaagaggtcattaaacgtgttgatgaaaatactatcggtgta
gtgccaacattaggggtgaccttcacctgtacttatgagccagtaaaagcggtacatgat
gcactcgatcaactacaaaaagagaccggacttgatattcctattcatgtcgatggtgcg
agtggtggctttttagcgcctttctgtgcacctgatttagaatgggatttccgtttaccg
cgtgttaaatccattaactcatcaggccataagtttggtttagcgccattgggctctggt
tgggtagtatggcgtgaagccaaagacttaccggaagagcttatttttaatgtgaactac
cttggcggtaatatgccaacctttgcgcttaatttctcacgtcccggtgggcaaattatt
gctcaatactataatttcttgcgtcttggcagagaagggtatgcgaagatccacaatgcc
tgttatcacaccgcgcaataccttgctcgagaaattgaaaagctagggccttttgaaatg
atcttcagtggtgatagtcaaaaaggaatacctgcattagcgtggaaactgaaaaaagag
gctaaggtaagctactccttatatgacatcgctgataaattgcgtagccgtggctggcaa
gtacccgcttattctatgcctgctgatcgccaagatttagttattcaacgtattcttgtt
cgtcatggtgtgagtttagatttggcgacattactgatagaagatatgaaacgtactctc
gattatttcgaaaaacatcctgtcagcacacctttatctgaagaggacggcggtggcttt
aaccacagctaa

DBGET integrated database retrieval system