Pteropus vampyrus (large flying fox): 105291766 Help Entry 105291766         CDS       T07815                                  Symbol PFN1 Name (RefSeq) profilin-1   KO K05759   profilin Organism pvp  Pteropus vampyrus (large flying fox) Pathway pvp04015   Rap1 signaling pathway pvp04810   Regulation of actin cytoskeleton pvp05014   Amyotrophic lateral sclerosis pvp05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pvp00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     105291766 (PFN1)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     105291766 (PFN1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     105291766 (PFN1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     105291766 (PFN1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pvp04131]     105291766 (PFN1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:pvp04812]     105291766 (PFN1)    04147 Exosome [BR:pvp04147]     105291766 (PFN1) Membrane trafficking [BR:pvp04131]  Others   Actin-binding proteins    Others     105291766 (PFN1) Cytoskeleton proteins [BR:pvp04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      105291766 (PFN1) Exosome [BR:pvp04147]  Exosomal proteins   Proteins found in most exosomes    105291766 (PFN1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  105291766 NCBI-ProteinID:  XP_011358031 UniProt:  A0A6P3Q6Z8 LinkDB All DBs Position Unknown AA seq 140 aa AA seqDB search MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFF VNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNITVTMTAKTLVLLMGKEGVH GGMINKKCYEMASHLRRSQY NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccgggtggaacgcctacatcgacaacctcatggcggacgggacctgtcaggacgcg gccatcgtgggctataaggactcgccctccgtctgggccgccgttcccgggaaaaccttc gtcaacatcacgccagctgaggttggtgtcttggttggcaaagaccggtcaagttttttc gtgaatgggctgacacttgggggccagaaatgttctgtgattcgggactcactgctgcag gatggggaatttaccatggatcttcgtaccaagagcaccggcggagcccccaccttcaat atcactgtcaccatgactgccaagacgctagtcctgctgatgggcaaagaaggtgtccac ggcggtatgatcaacaagaaatgttatgaaatggcctctcacctgcggcgttcccagtac tga

DBGET integrated database retrieval system