Pteropus vampyrus (large flying fox): 105297999 Help Entry 105297999         CDS       T07815                                  Symbol RELA Name (RefSeq) transcription factor p65   KO K04735   transcription factor p65 Organism pvp  Pteropus vampyrus (large flying fox) Pathway pvp01523   Antifolate resistance pvp04010   MAPK signaling pathway pvp04014   Ras signaling pathway pvp04024   cAMP signaling pathway pvp04062   Chemokine signaling pathway pvp04064   NF-kappa B signaling pathway pvp04066   HIF-1 signaling pathway pvp04071   Sphingolipid signaling pathway pvp04137   Mitophagy - animal pvp04151   PI3K-Akt signaling pathway pvp04210   Apoptosis pvp04211   Longevity regulating pathway pvp04218   Cellular senescence pvp04380   Osteoclast differentiation pvp04613   Neutrophil extracellular trap formation pvp04620   Toll-like receptor signaling pathway pvp04621   NOD-like receptor signaling pathway pvp04622   RIG-I-like receptor signaling pathway pvp04623   Cytosolic DNA-sensing pathway pvp04625   C-type lectin receptor signaling pathway pvp04657   IL-17 signaling pathway pvp04658   Th1 and Th2 cell differentiation pvp04659   Th17 cell differentiation pvp04660   T cell receptor signaling pathway pvp04662   B cell receptor signaling pathway pvp04668   TNF signaling pathway pvp04722   Neurotrophin signaling pathway pvp04917   Prolactin signaling pathway pvp04920   Adipocytokine signaling pathway pvp04926   Relaxin signaling pathway pvp04931   Insulin resistance pvp04932   Non-alcoholic fatty liver disease pvp04933   AGE-RAGE signaling pathway in diabetic complications pvp04936   Alcoholic liver disease pvp05010   Alzheimer disease pvp05022   Pathways of neurodegeneration - multiple diseases pvp05030   Cocaine addiction pvp05132   Salmonella infection pvp05133   Pertussis pvp05134   Legionellosis pvp05135   Yersinia infection pvp05140   Leishmaniasis pvp05142   Chagas disease pvp05145   Toxoplasmosis pvp05146   Amoebiasis pvp05152   Tuberculosis pvp05160   Hepatitis C pvp05161   Hepatitis B pvp05162   Measles pvp05163   Human cytomegalovirus infection pvp05164   Influenza A pvp05165   Human papillomavirus infection pvp05166   Human T-cell leukemia virus 1 infection pvp05167   Kaposi sarcoma-associated herpesvirus infection pvp05168   Herpes simplex virus 1 infection pvp05169   Epstein-Barr virus infection pvp05170   Human immunodeficiency virus 1 infection pvp05171   Coronavirus disease - COVID-19 pvp05200   Pathways in cancer pvp05202   Transcriptional misregulation in cancer pvp05203   Viral carcinogenesis pvp05207   Chemical carcinogenesis - receptor activation pvp05208   Chemical carcinogenesis - reactive oxygen species pvp05212   Pancreatic cancer pvp05215   Prostate cancer pvp05220   Chronic myeloid leukemia pvp05221   Acute myeloid leukemia pvp05222   Small cell lung cancer pvp05235   PD-L1 expression and PD-1 checkpoint pathway in cancer pvp05321   Inflammatory bowel disease pvp05415   Diabetic cardiomyopathy pvp05417   Lipid and atherosclerosis pvp05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pvp00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     105297999 (RELA)    04014 Ras signaling pathway     105297999 (RELA)    04064 NF-kappa B signaling pathway     105297999 (RELA)    04668 TNF signaling pathway     105297999 (RELA)    04066 HIF-1 signaling pathway     105297999 (RELA)    04071 Sphingolipid signaling pathway     105297999 (RELA)    04024 cAMP signaling pathway     105297999 (RELA)    04151 PI3K-Akt signaling pathway     105297999 (RELA)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     105297999 (RELA)   09143 Cell growth and death    04210 Apoptosis     105297999 (RELA)    04218 Cellular senescence     105297999 (RELA)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     105297999 (RELA)    04620 Toll-like receptor signaling pathway     105297999 (RELA)    04621 NOD-like receptor signaling pathway     105297999 (RELA)    04622 RIG-I-like receptor signaling pathway     105297999 (RELA)    04623 Cytosolic DNA-sensing pathway     105297999 (RELA)    04625 C-type lectin receptor signaling pathway     105297999 (RELA)    04660 T cell receptor signaling pathway     105297999 (RELA)    04658 Th1 and Th2 cell differentiation     105297999 (RELA)    04659 Th17 cell differentiation     105297999 (RELA)    04657 IL-17 signaling pathway     105297999 (RELA)    04662 B cell receptor signaling pathway     105297999 (RELA)    04062 Chemokine signaling pathway     105297999 (RELA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     105297999 (RELA)    04917 Prolactin signaling pathway     105297999 (RELA)    04926 Relaxin signaling pathway     105297999 (RELA)   09156 Nervous system    04722 Neurotrophin signaling pathway     105297999 (RELA)   09158 Development and regeneration    04380 Osteoclast differentiation     105297999 (RELA)   09149 Aging    04211 Longevity regulating pathway     105297999 (RELA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105297999 (RELA)    05202 Transcriptional misregulation in cancer     105297999 (RELA)    05207 Chemical carcinogenesis - receptor activation     105297999 (RELA)    05208 Chemical carcinogenesis - reactive oxygen species     105297999 (RELA)    05203 Viral carcinogenesis     105297999 (RELA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     105297999 (RELA)   09162 Cancer: specific types    05212 Pancreatic cancer     105297999 (RELA)    05221 Acute myeloid leukemia     105297999 (RELA)    05220 Chronic myeloid leukemia     105297999 (RELA)    05215 Prostate cancer     105297999 (RELA)    05222 Small cell lung cancer     105297999 (RELA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     105297999 (RELA)    05170 Human immunodeficiency virus 1 infection     105297999 (RELA)    05161 Hepatitis B     105297999 (RELA)    05160 Hepatitis C     105297999 (RELA)    05171 Coronavirus disease - COVID-19     105297999 (RELA)    05164 Influenza A     105297999 (RELA)    05162 Measles     105297999 (RELA)    05168 Herpes simplex virus 1 infection     105297999 (RELA)    05163 Human cytomegalovirus infection     105297999 (RELA)    05167 Kaposi sarcoma-associated herpesvirus infection     105297999 (RELA)    05169 Epstein-Barr virus infection     105297999 (RELA)    05165 Human papillomavirus infection     105297999 (RELA)   09171 Infectious disease: bacterial    05132 Salmonella infection     105297999 (RELA)    05135 Yersinia infection     105297999 (RELA)    05133 Pertussis     105297999 (RELA)    05134 Legionellosis     105297999 (RELA)    05152 Tuberculosis     105297999 (RELA)   09174 Infectious disease: parasitic    05146 Amoebiasis     105297999 (RELA)    05145 Toxoplasmosis     105297999 (RELA)    05140 Leishmaniasis     105297999 (RELA)    05142 Chagas disease     105297999 (RELA)   09163 Immune disease    05321 Inflammatory bowel disease     105297999 (RELA)   09164 Neurodegenerative disease    05010 Alzheimer disease     105297999 (RELA)    05022 Pathways of neurodegeneration - multiple diseases     105297999 (RELA)   09165 Substance dependence    05030 Cocaine addiction     105297999 (RELA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105297999 (RELA)    05418 Fluid shear stress and atherosclerosis     105297999 (RELA)    05415 Diabetic cardiomyopathy     105297999 (RELA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     105297999 (RELA)    04932 Non-alcoholic fatty liver disease     105297999 (RELA)    04931 Insulin resistance     105297999 (RELA)    04933 AGE-RAGE signaling pathway in diabetic complications     105297999 (RELA)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     105297999 (RELA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:pvp03000]     105297999 (RELA) Transcription factors [BR:pvp03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Rel/Ankyrin     105297999 (RELA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RHD_DNA_bind RHD_dimer Motif Other DBs NCBI-GeneID:  105297999 NCBI-ProteinID:  XP_011367280 UniProt:  A0A6P3QQN7 LinkDB All DBs Position Unknown AA seq 535 aa AA seqDB search MDMFYILIVVMDVHGSGFSPAVSGRLCLGVKSGIPEPLGCSLYFGQINGYTGPGTVRISL VTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAINQRIQT NNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLSPVLSHPIFDNRAPNTAELKI CRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPP YADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKS PFNGPTDPRPPPRRIAVPSRSSTSVPKPAPQSYPFTPSLSTINFEEFAPVVFSSGQMPSQ TPALASVPAPVLAHVPAPAPAMASALAQASTPVPVLASGLAQAVAPPAPKPTQAGEGTLS EALLQLQFDADEDLGSLLGNNTDPAVFSDLASVDNSEFQQLLNQGVSLASHTAEPMLMEY PESITRLVTGSQRPPDPAPTPLGASGLPNGLLSGDEDFSSIADMDFSALLSQISS NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt atggacatgttctatatcttgatcgtggtgatggatgtacatggatcaggcttctctcca gctgtgtctggccgtctgtgtctgggagttaagtctgggattcctgagcctctagggtgc tctctgtactttggacagatcaatggctacacgggaccagggacagttcgcatctccttg gtcaccaaggacccccctcaccggcctcacccccatgagctggtggggaaagactgccgg gatggcttctatgaggctgagctctgcccagaccgctgcatccacagcttccagaacctg gggatccagtgtgtgaagaagcgggacctggaacaggccatcaatcagcgcatccagacc aacaacaaccccttccaagttcccatagaagagcagcgtggggactacgacttgaatgct gttcggctctgcttccaggtgacagtgcgggacccgtcaggcaggcccctccgcctgtca cctgtcctctctcatcccatctttgacaaccgcgcccccaacacagcagagctcaagatc tgccgagtgaaccgcaactccgggagctgcctcggtggggatgagattttcctgctgtgt gacaaggtgcagaaagaggacattgaggtgtacttcactggacccggctgggaggcccga ggctccttttcgcaagccgatgtccatcgacaagtggctattgtgttccggacccctccc tatgccgaccccagcttgcaggcccccgtgcgtgtctccatgcagctgcggcggccttca gatcgggagctcagcgagcccatggaattccagtacttgccagacacagacgaccgtcac cggattgaggagaaacgtaaaaggacatatgagaccttcaagagcatcatgaaaaagagt cctttcaatggacccactgacccccggcctccaccccggcgcattgccgtgccttcccgc agctccacttccgtccccaagccagctccccagtcctatccctttacgccatccctcagc accatcaactttgaggagtttgcccctgtggtcttttcctctgggcagatgccaagccag accccagccttggcgtcagtccctgccccagtcctggcccacgtgccagcccctgcccca gccatggcatcagctctggctcaggcctcaacccctgtcccagttctagcctcaggcctt gctcaggctgtggccccacctgctcccaagcccacccaggctggggaaggaacactgtcc gaggccctgctgcagctgcagtttgatgctgatgaagacctggggtctctgctcggcaat aacactgacccagctgtgttctcggacctggcatctgtcgacaactccgagtttcagcag ctgctgaaccagggtgtatctctggcctcccatacagcagagcccatgctgatggagtat cctgagtctataactcgcctggtgacagggtcccagaggcctcctgacccagcgcccact cccctgggggcctctgggctccccaacggcctcctctcaggagatgaagacttctcctct attgcagatatggacttctcagcccttctgagtcagatcagctcctaa

DBGET integrated database retrieval system