KEGG   Phaseolus vulgaris (common bean): PHAVU_004G064800gHelp
Entry
PHAVU_004G064800g CDS       T03093                                 

Definition
(RefSeq) hypothetical protein
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
pvu  Phaseolus vulgaris (common bean)
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Photorespiration
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:pvu00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PHAVU_004G064800g
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    PHAVU_004G064800g
Enzymes [BR:pvu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     PHAVU_004G064800g
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
4
AA seq 180 aa AA seqDB search
MASSMISSPAVTTVNRAGAGAGMVAPFTGLKSLGGFPSRKMNNDITSVANNGGRVQCIQV
WPTVGKKKFETLSYLPPLTKEQLAKEVDYLLRKGWVPCLEFELEHGFVYREHNKSPGYYD
GRYWTMWKLPMFGCTDSSQVLKELYEAQTAHPDGFIRIIGFDNVRQVQCISFIAYKPPGY
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atggcttcttcaatgatctcctcccccgctgtgacgaccgttaaccgtgccggtgccggt
gccggtatggtggctcctttcactgggctgaagtccctgggagggttcccaagcaggaag
atgaacaatgatattacttccgttgcgaacaacggtggaagagtgcaatgcattcaggtg
tggccaacagttgggaagaagaagttcgagactctttcgtacctgccacccctgacaaaa
gaacaattggcaaaggaagtagactaccttcttcggaaaggatgggttccgtgcttggaa
ttcgaattggagcatggtttcgtgtaccgtgaacacaacaagtcacctggatactatgat
ggaaggtactggacgatgtggaagctgcctatgtttgggtgcactgattcttctcaggtg
ttgaaggagctttacgaggctcagactgctcatcccgatggtttcatccgtatcattgga
tttgacaacgttcgtcaagtgcagtgcatcagtttcattgcctacaagccaccaggctac
taa

DBGET integrated database retrieval system