KEGG   Pectobacterium parmentieri WPP163: Pecwa_0572Help
Entry
Pecwa_0572        CDS       T01106                                 

Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  
phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
pwa  Pectobacterium parmentieri WPP163
Pathway
Phosphonate and phosphinate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pwa00001]
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    Pecwa_0572
Enzymes [BR:pwa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     Pecwa_0572
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
618519..619451
Genome map
AA seq 310 aa AA seqDB search
MSIILPHHAPTDSYKGCTPGSRRSALRELLQQQKGIRVMEAHSPLSALLIEQAAYEDGDI
HYQFDAFWSSSLTDSTLRGKPDTELVDISHRFQAITEIFDVTTRPLIFDGDTGGQTEHLS
HRIRAAENLGISAMIIEDKTGLKKNSLFGNDVKQTQASVADFCEKITTAKKAQLTPEFML
IARIESLILDVGMEDAINRALHYADAGADGIMIHSRHKNPSEILAFAKQFRDHYPHLPLV
CVPTSFNDITFDQLIDGGFNIVIYANHMLRAAYPAMKSILPEILKHGRTLEVEDQCMSIK
DILDLIPGTR
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgtctatcattttacctcatcatgccccaacggattcatataaggggtgtacgccaggc
tcacgtcgtagtgcactccgtgaattattgcagcagcaaaaaggcattcgtgtgatggag
gctcacagtccgctttctgctttattaatcgagcaagctgcttatgaagatggcgatatt
cattatcaatttgatgcgttttggtctagctcactcaccgattccactttgcgtggaaaa
cccgatacggagttagtagacatcagtcatcgttttcaagcgattacggaaatatttgat
gttactacccgcccattaatttttgacggtgatactggcgggcaaactgaacatttatcc
caccggatccgtgccgccgaaaatctgggtatttccgccatgattatcgaagataaaacc
ggtctgaaaaagaactctttatttggtaatgatgtaaagcaaacgcaggcttctgtagcg
gatttttgcgaaaaaattacgactgcaaaaaaagcacaactgacgcccgagtttatgtta
atcgcgcgtattgagagcctgattctggacgtcggtatggaagatgcgataaaccgagcc
ttacattatgctgatgccggtgccgatggcattatgatccacagtcggcataagaaccct
tctgagattttagctttcgctaaacaattccgcgatcattatccacatttacctttggtt
tgtgttcctaccagttttaacgatattactttcgatcaactgattgatggtggattcaat
attgttatttacgcaaaccatatgttacgtgcggcttatcctgcgatgaaatcaatttta
ccagaaatcctcaagcatggtcgaacgctggaagttgaggatcaatgcatgtcgataaaa
gatattcttgatcttatacccggcacgcgatag

DBGET integrated database retrieval system