KEGG   Plutella xylostella (diamondback moth): 105385881Help
Entry
105385881         CDS       T03915                                 

Definition
(RefSeq) annulin
  KO
K05619  
transglutaminase 1 [EC:2.3.2.13]
Organism
pxy  Plutella xylostella (diamondback moth)
Brite
Enzymes [BR:pxy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     105385881
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 766 aa AA seqDB search
MGQVKSRLARCCPPQCGCCGGRATASYDLKELPRPPRLDMSNDVIDGTRQGVLAVQGIDF
CHEANGEDHHTGKFHLMTRSVGRSLVVRRGQAFKLDLLLNRPYDANRDNISFIFYVADVE
KRGPSDDTSAAVPLLEKGSETLGSWNAVYEGQMDLHLMVAVTPAADCIVAAWNIDIDTKL
TGGGSLSYTHPQPIYVLFNPWCLNDTVYMPGHSHREEYVQEDGGLMFRGVYNRIKPTPWN
YAQYEKDILECSLYLVREIGKVKGRARSDPIRTARALSAAVNVQDDNGVLMGNWASELSD
YSGGTHPVKWVGSLAIIQKYYEKKKPVKYAQCWVYAGVLTTVCRALGIPCRPVSGYNAAH
DSQGSLTIDVIKDDDGSTLEEFTKDSIWNYHVWNEVWMERPDLGAEYGGWQAIDATPQET
SEDVFRCGPASLRAVRDGELQRPYDAGYVFAQVNADKVLWKYSGEIQPLKLLARDTTSIG
KNISTKAIGKMEREDITNIYKYPEQTYEERLTMEKALRKSESIFARYYLNDAFNDILFEF
ELRDDIKIGQDFNVILHIKNRSHYSPHQVKGVLRVDTVTYTGITGDGVKRYEFDLSMAPE
GKEQVQLLVTFDDYYKKLVDQASFNIACLASIVDTKFDYFAQDDFRVRNPDIKISIEGKP
VSRKEFTATVKVENPLPIPLKKGKFYIQGPGLDEQLKIELDENVAPGTVASAQFQLTPPW
AGRHQISAKFSSKEMKDVDGFLSFIVAPQAEVNGTSSSANNESNEI
NT seq 2301 nt NT seq  +upstreamnt  +downstreamnt
atgggtcaagtgaagagtcgtctggcgaggtgctgccccccgcagtgtggatgctgcggt
ggtcgtgcgaccgcgtcgtacgacctgaaggagctgcccaggccgcctagactggacatg
tccaatgacgtgatcgatggcacacgacaaggcgtcctggcggtgcaaggcatcgacttc
tgccacgaggcgaatggcgaggaccaccacaccggcaagttccacctgatgacgaggagt
gtgggccgcagcctcgtggtgcgccgcggacaggccttcaagctcgacctgctgctcaac
cgcccctacgacgctaacagagacaatatttctttcatattctacgttgctgatgtggaa
aagcgaggtccgtcagacgatacttccgctgctgttccgttattggagaaaggttcggag
acgcttggatcctggaatgcagtgtacgagggtcagatggacctgcacctcatggtggcc
gtgaccccggccgccgactgcatcgtcgccgcctggaacatcgacatcgacaccaagctc
acaggaggagggtccctgagctacacacaccctcagcctatctacgtattgtttaatcca
tggtgtttgaacgacacagtctacatgccaggtcacagtcacagagaagaatatgtgcaa
gaagacgggggtctgatgtttagaggagtctacaatagaatcaaaccaacgccgtggaat
tacgcacagtatgaaaaagatatactcgaatgttctctttatctagtcagagagattgga
aaggtgaaaggtcgcgcaaggagtgacccaattaggacggctagagcactatcagccgcc
gtcaatgtccaagatgataatggggttctcatggggaactgggcttctgaactcagtgac
tacagcggtggcactcaccccgtcaagtgggttgggtctctggcgataatacagaagtat
tatgagaagaagaagccagtaaagtatgcccagtgctgggtgtatgccggcgtcttgacc
actgtttgcagagctttgggtattccctgtaggcccgtgagcggctacaacgcggcgcac
gacagtcagggcagcctcaccatagatgtcatcaaagacgatgacggcagcactctagag
gaattcaccaaggactccatatggaactatcacgtctggaatgaggtgtggatggagagg
ccagacttaggagctgagtatggcggatggcaggccatagacgccactccgcaggagacg
tcggaagatgtcttcagatgtggcccggcctcgctcagggccgtgagagacggggagctg
caacggccttatgatgccggatatgtgttcgcccaagtcaatgctgataaggttctatgg
aaatactcgggtgaaattcagccgctgaagttattggcgcgcgacacaacttctatcggc
aaaaacatttctaccaaagccatcggcaaaatggagagggaggacatcacaaacatctac
aagtacccggagcagacgtacgaggagcggctcacgatggagaaggcgctgcgcaagtcg
gagagcatcttcgcgcgctactacctgaacgacgccttcaacgacatcctgttcgagttc
gagctccgggacgacatcaagattggacaggatttcaatgtcatactgcacataaagaac
cgctcgcactacagtccgcaccaagtgaagggcgtcctccgcgtcgatacggtcacctac
accggcatcacgggcgacggcgtgaagcgctacgagttcgacctgtccatggctccggaa
ggcaaggagcaggtccagctgctggtcaccttcgacgactattataagaaacttgtggat
caggcctccttcaacatcgcctgcttagcgtcaatcgttgacaccaaattcgattacttc
gcccaagacgatttccgtgttcgcaaccccgacatcaagattagcatcgaagggaaacca
gtgtccaggaaagaattcacagctaccgtcaaagtagagaatcctctaccgataccactg
aagaagggaaagttctacattcaaggaccagggctggatgagcagctgaagattgaactc
gatgaaaacgtagctccagggacagtggcatcggctcagttccagctgactccgccgtgg
gcaggtcggcaccagatatctgccaagttctcctccaaagagatgaaggacgtggacggg
ttcctctccttcatcgtggcaccacaagccgaagtcaacggcacttcttctagcgctaat
aacgagagcaatgagatttga

DBGET integrated database retrieval system