KEGG   Plutella xylostella (diamondback moth): 105392336Help
Entry
105392336         CDS       T03915                                 

Definition
(RefSeq) angiotensin-converting enzyme-like
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
pxy  Plutella xylostella (diamondback moth)
Brite
Enzymes [BR:pxy01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     105392336
Peptidases [BR:pxy01002]
 Metallo Peptidases
  Family M2
   105392336
Exosome [BR:pxy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   105392336
CD molecules [BR:pxy04090]
 Proteins
  105392336
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 697 aa AA seqDB search
MGTGKVSFVIVQLFAFFTWHAIAQEYVRMGSNTNAAEAMQFLREYDREASGMCYRVTMSQ
WRFVTNITEYNRRRMLEELALNSKFERLSWRKAAAYDATRVSDVQSRRQLVKIVQGSRAA
LPEDKFNEIQQIITEMKEIYNAAKICPYGQKPYDSHLQRDSPFYPQSRQEPYDQTRSHNQ
DIYQPFGPGFPHETPENSNYCDMQLDPEISRILAHSRIESELVYVWKSFREQTGPKMKNR
FMRYVQLANQAAVSTGYSDAGDQMRASYEDPSFRASLEEIYNQVAPLYKQLFTYVRRKLI
QRYGERVVRPDGPIPAHLLGNMWAQNWKSIMDLVMPFPQAPNIDVTSEMLRQGFTPLRMF
QMAEEFYTSMGMKPAPPEFWRGSMLARPAERSVQCTASAWDFCNRIDYRIKQCTEVTMQD
LVSTHHEMAHIQYYLQYAEQPQLFRDGANPAFHEAVANAVTLSVYNIQHLQRVGLYNNRT
HDPYQVSMNFLMTMALEKVAYLPFAFMVDQWRWSVFEDGVQNMNSRWWQMKLRFQGVIPP
MQRTEADFDPGSKYHVISDQEYIKYFLGTVLEFQLYEQLCQAAGQAGHLHECDVYRSRDA
GRLLSEIMQPGASKTASEIIRTMTRGRTNRISPESLVRYFRPLELWLRVQNRDEPLIGWS
SNYQDIGLFAPQRGHGIKATYSVVLLVLSIMQFLLFL
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atggggactggcaaagtgtcgtttgtcatagtccagttgtttgctttcttcacatggcat
gcgattgctcaggagtacgtcagaatgggttccaacacaaacgcagctgaggccatgcag
tttctacgggaatacgacagagaagcttctggaatgtgctacagagtaacaatgtcgcaa
tggcgcttcgtcaccaacataaccgagtacaaccggcgacggatgctggaggaactagcc
ttaaactccaagttcgagagactctcatggcgtaaagccgcagcgtatgacgccaccagg
gtctccgatgtgcagagtaggaggcagctagtgaagatcgtgcagggaagccgggcggcg
ctgcctgaggataagtttaatgagatccaacaaataataaccgaaatgaaggaaatatac
aacgcagccaaaatctgcccttacggacagaagccctacgattcccatctgcaaagagac
agcccattctaccctcaaagtcgacaggaaccttacgaccaaaccagatcccacaaccaa
gatatctaccagccgtttggcccagggtttcctcacgaaacgcctgagaactccaattat
tgcgacatgcagttggaccctgagatatcgaggatattggcgcactcaaggattgagagt
gagctggtgtatgtttggaagagttttcgggaacagactggaccgaagatgaagaatcgg
ttcatgagatacgtgcagctggccaaccaggctgctgttagtactggttactccgacgcc
ggcgaccagatgcgtgcctcatatgaggacccctcattccgagcgtctctggaagagatc
tacaaccaggtggcgccactgtacaagcagttattcacgtatgtgcggaggaagctgatc
cagcggtacggggagagggttgttaggcctgatgggcccataccggcgcatttgttaggt
aacatgtgggcgcagaactggaagtcgataatggatcttgtgatgccgttcccgcaggct
cccaacattgatgtcacctcggagatgctgagacaagggttcacgcctttgagaatgttc
cagatggcggaagagttctacacgtcgatgggcatgaagcccgcgccgccggagttctgg
cgcggctccatgctggcgcggccggcggagcgcagtgtgcagtgcactgctagcgcgtgg
gacttctgcaataggattgattataggatcaagcagtgcacggaggtgacgatgcaggac
ctggtctccacgcaccacgagatggctcacatccagtactacttgcagtacgcggagcaa
ccgcagctgttcagagacggggctaatccagcgttccatgaagcggtggcgaatgcggtg
actctctccgtgtacaacatccaacatctgcagagagtcggcctctacaacaacagaacg
catgacccctaccaagtgagcatgaacttcctgatgacgatggcgctggagaaggtcgcc
tacctgcccttcgcgttcatggtggaccagtggcggtggtcagttttcgaagacggtgta
caaaatatgaactccagatggtggcagatgaaactacgatttcagggtgtgatcccgcca
atgcagaggactgaagcagactttgacccgggatccaaataccacgttatttctgatcag
gagtacataaagtacttcctcggcacggtgctggagttccagctctacgagcagctgtgc
caggcggcggggcaggcggggcacctgcacgagtgcgatgtgtataggagccgagatgct
gggaggctgctcagtgagataatgcagccgggcgcatcaaagactgcgtcggagatcatt
cgcaccatgacgcgaggcagaaccaatcgaatatcaccagagtctttagtcagatacttc
cgccctctagagctgtggcttcgagtccagaaccgtgacgaacctctcataggatggagc
tccaactatcaggacataggcctattcgcgccacaacgaggccacgggataaaagctaca
tactctgtggtccttctagtgttgtctattatgcagtttcttttgtttttatag

DBGET integrated database retrieval system