KEGG   Plutella xylostella (diamondback moth): 105395382Help
Entry
105395382         CDS       T03915                                 

Definition
(RefSeq) uncharacterized LOC105395382
Organism
pxy  Plutella xylostella (diamondback moth)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 366 aa AA seqDB search
MAKQRVGIVFGGKSAEHEVSLQSAKNIVDAIDKSRFDVVLLGIDKQGQWHVNDASQYLLN
AHDPAHIALNPSEVSVATVPGVVKGQLIDAGNAQALAQIDVVFPIVHGTLGEDGSLQGML
RMANLPFVGSDVLGSAACMDKDVTKRLLRDAGLNIARFVTLTRANRDKHTFAQISGELGL
PLFVKPANQGSSVGVSKVTSEAEFTQAVRLAFEFDHKVVVEQGIKGREIECAVLGNDFPQ
ASTCGEVVLNSDFYSYDTKYIDDKGAQVVVPADLDPAVNDKIRAIAIRAYQTLGCCGMAR
VDVFLTAENEVVINEINTLPGFTNISMYPKLWQASGLSYPELITRLIELALERHAADSAL
KSSVNG
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggctaagcagcgcgtaggtattgtctttgggggaaaatcagcggagcacgaagtgtca
ttgcaatcggctaaaaatatcgttgatgcgatcgataaaagccgtttcgacgtggtgctg
ctgggcattgataaacagggccagtggcacgttaacgatgccagccagtatctgctcaat
gctcacgatccggcacacatcgccctgaatccttcagaagtgagcgtcgccaccgtaccc
ggcgtcgtgaaggggcagcttatcgacgccggcaatgcacaggctctcgcccagatcgac
gtcgtcttccctatcgttcacggtaccctgggggaagatggttccctgcagggaatgctg
cgcatggccaacctgccgttcgtcggctcggatgtcctcggctctgccgcctgcatggac
aaagacgtgaccaaacgcctgctgcgcgacgccgggctaaatattgcccggttcgttacg
ctcacccgcgccaaccgcgacaaacacaccttcgcgcaaatcagcggagagctgggtctg
ccgctgtttgtgaagcctgcaaaccagggctcctccgtgggcgtcagcaaagtgaccagc
gaagctgagttcacgcaagctgtccgcctggcgtttgagttcgaccataaagtggtggtt
gagcagggcatcaaaggccgtgaaattgagtgcgccgtgctgggcaacgattttccacag
gcgagcacctgcggcgaagtggtcttaaacagcgacttctactcgtacgacaccaaatac
attgatgataaaggcgcgcaggttgtcgtgcctgcggatctcgatccggcggttaacgat
aagatccgggcgatcgccattcgcgcttatcagacgctcggctgctgcggcatggcgcgc
gtggatgtgttcctgacggcggaaaacgaggtggtgatcaatgaaattaacacgctgccg
gggttcactaacatcagcatgtatccgaagctgtggcaggcgagcggcctgagctacccg
gaattgatcacccgcctgatcgaactggcgctggagcgtcacgccgccgacagcgcgctt
aaaagttccgtaaacggttaa

DBGET integrated database retrieval system