KEGG   Plutella xylostella (diamondback moth): 105397528Help
Entry
105397528         CDS       T03915                                 

Definition
(RefSeq) superoxide dismutase [Mn], mitochondrial-like
Organism
pxy  Plutella xylostella (diamondback moth)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 244 aa AA seqDB search
MGSAAALLLMLLLVVAKPRPNQTAQVMNALGANQPQITANYTLPSLPYAYDALEPHFDKQ
TMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITKLDQLPADKKTVLRNNAGGHANH
SLFWKGLKTGTTLQGDLKAAIERDFGSVDNFKAEFEKAAATRFGSGWAWLVLKGDKLAVV
STANQDSPLMGEAISGASGFPILGLDVWEHAYYLKFQNRRPDYIKAFWDVVNWDEAAARF
AAKK
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgggttcggcggcggcgctgctgttgatgctgctgctggtggtcgcaaagcctagaccc
aaccagacggcgcaggtaatgaatgcgctgggtgccaaccagccgcagatcacggcgaat
tatacactgccatccctgccgtatgcctacgacgcactggaaccgcatttcgacaagcag
acgatggaaatccatcacactaaacaccaccagacctatgtgaacaacgcgaacgccgcg
ctggaaagcctgcctgagttcgctaacctgcctgttgaagagctgatcaccaagctggac
cagctgccagcggacaagaaaaccgtgctgcgcaacaacgcgggcggtcacgctaaccac
agcctgttctggaaaggcctgaaaaccggtactaccctgcagggcgacctgaaagcggct
atcgagcgcgacttcggttccgttgacaacttcaaagcggagttcgagaaagccgctgca
acccgtttcggctccggctgggcgtggctggtactgaaaggtgacaaactggccgtggtt
tctaccgcgaaccaggactccccgctgatgggtgaagcgatctctggcgcatccggtttc
ccaatcctgggtctggacgtgtgggaacacgcttactacctgaaattccagaaccgtcgt
ccggactacatcaaagccttctgggacgtggtgaactgggacgaagcagcagcgcgtttc
gccgctaaaaaataa

DBGET integrated database retrieval system