KEGG   Pyrococcus kukulkanii: TQ32_03835Help
Entry
TQ32_03835        CDS       T04365                                 

Definition
(GenBank) aldehyde:ferredoxin oxidoreductase
  KO
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
pyc  Pyrococcus kukulkanii
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pyc00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    TQ32_03835
Enzymes [BR:pyc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     TQ32_03835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
712141..713964
Genome map
AA seq 607 aa AA seqDB search
MYGYWGKILRVNLSDGTIKEEKFDESFAKKWLGTRGFGIYYLLKEMDPKVDPFSPENKLI
FATGPLTGTSAPTGGRYMVITKSPLTGYIAMANSGGYFGAELKFAGWDAIIVEGKADHPV
YIYINEESVEIRDASHLWGKLVSETEEKLKEEVGDKNVQIASIGPAGENKVRFAAVMNNG
HRAAGRGGVGAVMGSKNLKAIVVRGHKRVEVADKGKFMEVVREKIEKLKKDPVAGGGLPK
YGTAVLVNIINENGLYPTRNFQTGVFKYAYEQSGEAMAAKYLVRNKPCFACPIGCGRVNK
LPTLGVTEGPEYESTWALGANLGINDLAAIIEANHFADEYGMDTISLGGTLATAMELYER
GLLKQEDIGGDNVPPFRFGNTEVLHYWIHKIATREGFGDVLAEGGYRLAEKFNGLEYFMG
VKKQELPAYDPRGAEGHGLGYATNNRGGCHIKQYMISPEILGYPYKMDPHDISDEKVKMV
ILFQDLTALIDAAGLCLFTTFGLGADDYRDLLNAALGWDFSTEEYLKIGERIWNAERLFN
LKAGLDPLKEDTLPKRLLEEPMPEGPHKGHVVRLKEMLPRYYKFRGWTEDGRIPEEKLKE
LGLEEFM
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgtatgggtattggggcaagattctaagagtaaacctttctgatgggacgattaaggaa
gagaagttcgacgagagcttcgctaagaaatggcttggtacgaggggctttgggatctac
taccttctcaaggagatggatccaaaggtcgaccccttcagtccagagaacaagcttata
tttgcaacgggcccgctaacgggaacttccgctccaacgggcggaaggtacatggtgata
accaagagtcccctgacaggatatatagcgatggcaaactcgggcggctattttggtgct
gagcttaagttcgcagggtgggatgccataattgttgagggaaaggctgatcatccagtg
tatatttacatcaacgaggagagcgttgagataagggacgcctctcacctctggggcaag
ctagtaagtgagacggaagagaagctgaaggaggaagttggagataagaacgttcagata
gcctccattggaccggctggagaaaataaggttaggtttgcggcagtgatgaacaacgga
cacagggccgcgggaagaggtggagttggagcggttatgggaagcaagaatctcaaggca
atagtagttaggggacacaaaagagtagaggtcgctgacaaagggaagttcatggaggta
gtcagggagaagatcgaaaagttaaagaaggatcccgtggccggaggaggactgcctaag
tacggaactgccgttctcgtgaacattatcaacgagaatggactctatccaacgagaaac
ttccagactggagtgtttaaatatgcttatgagcagagcggtgaggcaatggctgccaag
tacttggttaggaacaagccctgctttgcctgtccaataggctgtggaagggtcaacaag
ttgccaaccctaggagttaccgaaggaccggagtacgagagcacatgggctcttggtgct
aaccttggaatcaacgatttagctgcgataatcgaagctaatcacttcgccgatgagtat
ggaatggacacgataagcctcggtggaaccttagcgacggcaatggagctctacgagagg
ggtctgctcaagcaggaggatattggaggagacaacgttccgcccttcaggttcggcaac
accgaagtgctacactactggatccacaagatagcaactagggagggctttggcgatgtc
cttgcagagggtggttataggttagctgaaaagttcaacggcctcgagtacttcatgggc
gttaaaaagcaggaacttccagcctatgatccaaggggtgccgagggccacggacttggt
tacgcgaccaacaacaggggaggctgtcacatcaagcagtacatgataagccctgagatc
ctgggttacccctacaagatggatccgcacgacataagcgacgagaaggttaagatggtc
atcctgttccaagatcttacggcgttaattgacgccgcaggcctatgtctgttcaccacg
tttggattaggtgcggatgactacagggatctcctaaatgcagcgctaggctgggacttc
tcaactgaggagtacctcaagataggagagaggatatggaatgctgagaggctgttcaac
ctcaaagctggccttgacccgctcaaagaggatacattgcctaagaggctccttgaagag
ccaatgccagaagggccgcataagggacacgtggtcaggctcaaggagatgctaccaagg
tactacaagttcagaggatggacagaagacggaagaattccagaggagaagcttaaggag
cttgggcttgaggagttcatgtga

DBGET integrated database retrieval system