KEGG   Pyrococcus kukulkanii: TQ32_05845Help
Entry
TQ32_05845        CDS       T04365                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
pyc  Pyrococcus kukulkanii
Pathway
pyc00630  Glyoxylate and dicarboxylate metabolism
pyc01100  Metabolic pathways
pyc01120  Microbial metabolism in diverse environments
pyc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pyc00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    TQ32_05845
Enzymes [BR:pyc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     TQ32_05845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N B12-binding
Motif
Other DBs
NCBI-ProteinID: AMM54046
UniProt: A0A127BBL7
LinkDB All DBs
Position
complement(1096517..1097779)
Genome map
AA seq 420 aa AA seqDB search
MKVEWYLDFVDLNYTPGRDELIVEYYFEPNGVSPEEAAGRIASESSIGTWTTLWKLPEMA
KKSMAKVFYLEKSGEGYIAKIAYPLTLFEEGSLVQLFSAIAGNVFGMKALKNLRLLDFHP
PYEYLRHFRGPQYGVKGIREFMGIKDRPLTATVPKPKMGWSVEEYAEIAYELWSGGIDLL
KDDENFTSFPFNRFEERVRKLYRVRDRVEAETGETKEYLINITGPVDVMEKRAELVANEG
GQYVMIDIVVAGWSALQYMREVTEDLGLAIHAHRAMHAAFTRNPKHGITMFALAKAARMI
GVDQIHTGTAVGKMAGNYEEIKRINDFLLSKWEHIRPVFPVASGGLHPGLMPELIRLFGK
DLVIQAGGGVMGHPDGPKAGAKALRDAIEAAVDGIDLEEKAKSSPELKKALEKWGYLKPK
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttgagtggtacctcgattttgttgacctaaactacaccccaggaagggacgag
cttatagttgagtactactttgagccgaacggcgtttctcctgaagaagctgctggaagg
atagcgagcgaaagctccattggaacgtggacgactctctggaagcttccggagatggca
aagaagagtatggcaaaggtgttctatttagagaaaagcggtgaaggttatatcgcgaag
atagcttatcccctaaccttgttcgaggagggaagcttagtccagctcttcagcgctata
gccggtaacgtgttcgggatgaaggccctgaagaacctgagattgctcgacttccatccc
ccgtatgagtatctgaggcacttcagagggcctcagtacggagttaagggaattagggaa
ttcatgggaatcaaggacaggcccctaaccgcaacggttccaaagccaaagatggggtgg
agcgttgaggaatatgctgagattgcttacgagctctggagcgggggtattgacctgctt
aaggatgacgagaacttcacaagctttccattcaacaggttcgaagagagggtgaggaag
ctctacagggtgagggacagggttgaggcagagaccggggagacaaaggagtatctgatc
aacatcaccggcccagtagatgtaatggagaagagggccgaattagtcgccaatgaaggc
ggacagtacgtgatgattgatatagtcgttgcgggatggagtgcacttcagtacatgagg
gaagtcaccgaagacttgggattggcaatccatgctcatagggcaatgcacgcagcattc
actaggaatcccaagcacggcataaccatgtttgctttggctaaggccgcaaggatgata
ggggttgaccagatccacaccggaaccgctgtaggaaagatggccggaaattatgaggaa
ataaagagaattaacgacttcctcttgagcaagtgggagcacataaggccagtgttccca
gtggcaagcggtggccttcaccctggcttgatgcccgagctgataaggctgttcgggaaa
gatcttgttattcaggccggaggcggcgtcatgggtcacccggatgggccaaaggccgga
gctaaagcattgagagatgctattgaggctgcagttgacggaatagaccttgaagagaag
gcaaaatcaagtcctgaactgaagaaggccttggagaagtggggctatcttaagccaaag
tag

DBGET integrated database retrieval system