KEGG   Pyrobaculum sp. WP30: PYWP30_00445Help
Entry
PYWP30_00445      CDS       T04013                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase, type 2
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pyw  Pyrobaculum sp. WP30
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:pyw00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PYWP30_00445
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    PYWP30_00445
   00680 Methane metabolism
    PYWP30_00445
Enzymes [BR:pyw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     PYWP30_00445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
383719..385143
Genome map
AA seq 474 aa AA seqDB search
MKNYKVFTSLRFMIPRLMCTQHPDATVKITSVEEVDEALVAFAAYGCEEVMVDYEGKTTP
YSQPKEIVAKCHQAELPLGERYFLTPRMPNPKLEEFERAMLTVEAALIANYFSVKLMGRQ
AVKWIVLPMVADVDTPHLVYRLLLRKQKIYEEELGTKWEPVEVIPLVEDAFAQLKVEDLL
GSLISKMEEKPKHVRLFLGKSDSAVKYGHLASSLAIVKLLSSLHRVEDRLGVKILPILGM
GSPPFRGGINNPRLVHMETVQYAGFNTVTVQSAVRYDVSYDEYSFVREVLLNACCLRTLR
LDVGGEVDTVITLASSNYRALLSKYAGKVAEVARLIPSTRERVSWTVYGRSVVAHDRVVN
MPRAIVYTATWYAMGLPPTLLDAPTIVELAKQDKLDAVLKALPTLKAELTYDAQFYDGAT
AEKYVGPELVKTVEEALDYLDIKERSGGIYQALLRSPRNESNVLAAGKYRKFLG
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattataaagtcttcacatctctgagatttatgatccccaggctcatgtgtaca
cagcatccagacgccactgttaagatcacgtctgtagaggaggtggacgaggcgctggtg
gccttcgcggcgtatggctgcgaggaggtgatggtggactacgaggggaagacgacgccg
tattcccagcctaaggagatcgtggctaagtgccaccaggctgagttgccgttgggggag
cggtatttcttgacccccaggatgccgaaccccaagctggaggagtttgaaagagccatg
ttgaccgtggaggcggctctcatcgccaactacttctcggtgaagctgatggggcggcag
gcggtgaagtggatcgtgttgcctatggtcgccgacgtagacacgcctcatctcgtgtac
aggttgcttctacgtaagcagaagatctacgaagaggagctggggactaagtgggagcca
gtggaggtcattccgcttgtggaagacgcctttgcgcaactgaaggtcgaagatctcctc
ggctctttgatctccaagatggaggagaagccgaagcacgtcaggcttttcctcggtaag
tcggactccgccgtgaagtacggccacctcgcctcatccttggctattgtaaaactgctg
tcgtctcttcaccgcgtcgaggataggctgggcgttaagatattacccatattggggatg
gggtccccgcccttccgcggcgggataaacaacccacgtctggtgcatatggagacggtg
cagtacgccggcttcaacacagtgactgtgcagtccgccgtcagatacgacgtgtcttac
gacgagtacagctttgtgagagaggttctcctcaacgcctgctgtctgcggacgttgcgg
ctggacgtcggcggcgaggtggataccgtaattacactggcctcctccaactacagagcc
ctcttgtctaagtatgcaggtaaggtcgcggaggtcgctaggctcatcccgtcgacgagg
gagagggtgagctggacagtgtatgggaggtcggtggtggcccacgaccgggtggtcaac
atgccgagggctatcgtctacaccgctacgtggtacgccatgggtctgccgccgactctc
ctcgacgcccccaccattgtggagctggcgaagcaagacaagctggacgcagtgctgaag
gccttgccgactcttaaggctgagctgacctacgacgcgcagttttacgacggggccacc
gccgagaaatacgtggggcctgaactcgtcaagacagtggaggaggctctcgactaccta
gacataaaagagaggagtggcggcatataccaagccctcctccggtcgccgcgtaacgaa
tctaacgtgctcgccgccggtaaatacaggaagttcttgggatag

DBGET integrated database retrieval system