KEGG   Rahnella sp. Y9602: Rahaq_2643Help
Entry
Rahaq_2643        CDS       T01422                                 

Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
rah  Rahnella sp. Y9602
Pathway
rah00240  Pyrimidine metabolism
rah01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rah00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Rahaq_2643
Enzymes [BR:rah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     Rahaq_2643
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_30 KdpD AAA_14
Motif
Other DBs
NCBI-ProteinID: ADW74250
JGI: Rahaq_2643
UniProt: A0A0H3FDT3
LinkDB All DBs
Position
complement(2876873..2877481)
Genome map
AA seq 202 aa AA seqDB search
MAQLYFYYSAMNAGKSTSLLQSSYNYQERGMRTLVLTAELDNRYGQGKVSSRIGLSSPAE
LYNTETELFNLVAQENRTQRLSCVLIDECQFLTKAQVSQLTDVVDDLDVPVLCYGLRTDF
RGELFEGSEYLLAWADKLVELKTICHCGRKANRNLRLDENGNALHDGAQVVIGGDESYVS
VCRKHYKEAMAAFDGRDESKTL
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggctcagctttatttctattactcggcgatgaatgccggtaagtccacctcgttgctg
caatcttcatataattatcaagaacgtggtatgcgcacgctggtgttaacagcagaactc
gataaccggtatggtcagggtaaagtcagttcgcgaatcggcttgtcgtctcctgcagag
ctttacaacacagagacagaactcttcaatctggtggctcaggagaaccgcacacagcgt
ttgagttgcgttctgattgatgagtgccagtttctcaccaaagctcaggtatcgcagctg
acggacgttgtggacgatctggatgtgcctgtactttgctatggtctgagaacggatttt
cgcggagaactttttgagggcagtgaatatctgctggcctgggcggataaactggttgag
cttaaaaccatctgccattgtggtcgcaaagccaaccgcaacctgagactggatgagaac
ggtaacgccttacatgatggcgcacaggtcgttattggcggtgatgaaagttatgtttcg
gtctgccgtaagcattacaaagaagcgatggctgcgtttgatggcagggatgaaagtaag
actctctaa

DBGET integrated database retrieval system