KEGG   Ruminococcus albus: Rumal_2911Help
Entry
Rumal_2911        CDS       T01387                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
ral  Ruminococcus albus
Brite
Translation factors [BR:ral03012]
 Eukaryotic Type
  Elongation factors
   Rumal_2911
 Prokaryotic Type
   Rumal_2911
Mitochondrial biogenesis [BR:ral03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Rumal_2911
Exosome [BR:ral04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Rumal_2911
  Exosomal proteins of breast cancer cells
   Rumal_2911
  Exosomal proteins of colorectal cancer cells
   Rumal_2911
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(3270856..3272055)
Genome map
AA seq 399 aa AA seqDB search
MAKAHFERTKPHVNIGTIGHVDHGKTTLTAAITKTLAMKGQAKFEAYDMIDKAPEERERG
ITINTAHVEYETDKRHYAHVDCPGHADYVKNMITGAAQMDGAILVCAASDGPMAQTREHI
LLARQVGVPAIVVFMNKADQVDDPELLELVEMDIRDLLSSYDFPGDDTPIIVGSALAALE
APDDLSDPAYEPIIKLMDAVDEYIPTPERDDAKPFLMPVEDTMTISGRGTVVTGRVERGV
LNTGETVEIVGLSDEKQSTVVTGIEMFRKTLDSAMAGDNIGALLRGITRDQVERGQVLCK
PGSIHPHTKFSGQVYVLKKEEGGRHTPFFNNYRPQFYFRTTDVTGIISLPADKEMCMPGD
NVTMDVELITPIAIEEGLRFAIREGGRTVGSGVVTAINE
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggcacattttgaaagaaccaagccccacgttaacattggtaccatcggtcac
gttgaccacggtaagactaccctgacagctgctatcaccaagacactggctatgaagggt
caggctaagtttgaggcttatgacatgatcgataaggctcccgaggagagagagagaggt
atcacaatcaataccgctcacgttgagtatgagactgataagagacactatgctcacgtt
gactgccccggccacgctgactacgttaagaacatgatcacaggtgctgctcagatggac
ggcgctatcctggtttgtgctgcttctgacggccctatggctcagacaagagagcacatc
ctgctggctcgtcaggttggcgttcctgcaatcgttgtattcatgaacaaggctgaccag
gttgacgatcctgagctgctcgagctggttgagatggatatcagagatctgctgagctct
tatgatttccctggcgatgatactcctatcatcgttggttctgctctggctgctcttgaa
gctcccgatgacctgagcgatcctgcttacgagcctatcatcaagctgatggacgctgtt
gacgagtacattcctactcctgagagagacgacgctaagcctttcctgatgcctgttgag
gatactatgaccatctccggccgtggtaccgttgttacaggtagagttgagagaggtgtt
ctgaacactggtgagaccgttgagatcgttggtctgtctgatgagaagcagtccacagtt
gtaaccggtatcgagatgttcagaaagactctggattccgctatggctggtgataacatc
ggcgctctgctccgtggtatcacaagagatcaggttgaaagaggtcaggttctttgtaag
cccggctccattcacccccacactaagttcagcggtcaggtttacgttctgaagaaggaa
gagggcggccgtcatactcctttcttcaacaactacagacctcagttctatttcagaaca
actgacgttaccggtatcatctctctgcctgctgacaaggagatgtgcatgcctggtgat
aacgtaactatggacgttgagctgatcactcctatcgctattgaagagggtctgcgtttc
gctatccgtgagggtggtagaactgtaggttccggcgttgttactgctatcaacgaataa

DBGET integrated database retrieval system