KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4420Help
Entry
Rahaq2_4420       CDS       T01770                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:raq00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Rahaq2_4420
  Energy metabolism
   00680 Methane metabolism
    Rahaq2_4420
Enzymes [BR:raq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Rahaq2_4420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
4705892..4708537
Genome map
AA seq 881 aa AA seqDB search
MNEQYSAMRSNVSTLGKLLGDTIKDTLGEHILDRVEKIRKLSKSSRAGNDADRQELLSTL
QNLSNDELLPVARAFSQFLNLANVAEQYHSISPHGEAASNPEALAQLFDRLKSKNLSEQQ
LRDAVDQLSIELVLTAHPTEIARRTLIHKLVEVNNCLKQLDHNDLADYERKQIMRRLRQL
IAQSWHTDEIRKNRPSPVDEAKWGFAVVENSLWEGVPAFLRELNEQLETSLDYKMPVEAV
PVRFTSWMGGDRDGNPNVTADITRHVLLLSRWKATDLFLRDIAVLVSELSMTECTPELRE
LAGGADIIEPYREIMKQLRSQLTNTQVYLEARLKGERVARPHDLLVKNDQLWAPLYACYQ
SLQACNMGIIANGQLLDTLRRVRCFGVPLVRIDVRQESTRHTDAIAEITRYLGLGDYESW
SESDKQAFLIRELNSKRPLVPRHWEPSADTKEVLDTCQVIAEAPEGSIAAYVISMARTPS
DVLAVHLLLKEAGCPFPMPVAPLFETLDDLNNADDVMKQLLSIDWYRGFIQGKQMVMIGY
SDSAKDAGVMAASWAQYRAQDALIKTCEKAGIALTLFHGRGGSIGRGGAPAQAALLSQPP
GSLKGGLRVTEQGEMIRFKFGLPEVTISSLALYTSAILEANLLPPPEPKQAWVDIMEQLS
DVSCKMYRGYIRENKDFVPYFRAATPEQELAKLPLGSRPAKRKASGGVESLRAIPWIFAW
TQNRLMLPAWLGAGAGLQAVVDGGKRDELETMCRDWPFFSTRIGMLEMVFAKADLWLAEY
YDHRLVEKELWPLGQQLRDQLASDIKVILAISNDDHLMEDLPWIAESIALRNVYTDPLNV
LQAELLHRSRELEKDGKQDANVEQALMVTIAGVAAGMRNTG
NT seq 2646 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattccgcaatgcgaagtaatgtcagtaccttaggtaaattgctgggc
gacacgatcaaagatacgttgggagagcatatcctggatcgtgttgagaaaatccgtaag
ctgtcgaaatcctcccgtgccggaaacgacgcggatcggcaggagttgctgtcaacattg
caaaatctctcaaatgatgagctgttgcctgttgcccgtgcttttagtcagtttctgaat
ttagccaacgtggctgaacaatatcacagcatttcgccacacggcgaagcggccagtaat
cctgaagcgctggcgcaattgttcgatcgactgaaatccaaaaatctctcagaacaacag
ttacgcgatgccgttgaccagctttctattgaactggtgctgactgcacacccgacagaa
atcgcccgccgcacactgatccacaaactggtcgaagtgaataactgcctcaagcagctc
gaccataacgatctggccgattacgaacgtaaacaaatcatgcgtcgtctgcgtcagttg
atcgcacagtcatggcataccgatgaaatccgtaagaaccgcccttcgccggtggatgaa
gctaaatggggctttgcggtggtcgaaaacagcctgtgggaaggcgtgcctgcgttcctg
cgtgaactgaacgaacaactggaaacctcactggattacaaaatgccagtggaagccgtg
ccggttcgtttcacttcctggatgggtggcgaccgcgacggtaacccgaacgtgaccgcc
gatatcacccgccacgtactgttgctgagccgctggaaagcgactgacctgttcctgcgc
gatatcgcggtgctggtgtcagaactgtcgatgactgaatgtaccccggaactgcgtgag
ctggcgggcggtgcggacatcatcgaaccttaccgtgaaatcatgaaacagctgcgttca
cagctgaccaatacccaggtgtatctggaagcccgtctgaaaggcgaacgcgttgcgcgt
cctcacgatttgctggtgaaaaatgaccagctgtgggcaccgctttacgcctgttaccag
tcattgcaggcctgcaacatgggcattatcgccaacggtcagttgctggataccctgcgc
cgcgtgcgttgcttcggcgtgccgctggtgcgtatcgatgtgcgtcaggaaagcacccgc
cacaccgatgctattgccgaaatcacccgctatctggggctgggtgattacgaaagctgg
tcagaatccgacaaacaggctttcctgatccgcgaactcaattcaaaacgtccgctggtg
ccacgccactgggaaccgagcgccgacaccaaagaagtgctcgatacctgtcaggtgatc
gccgaagcaccggaaggctcgattgcggcgtatgttatttcgatggcgcgcacgccgtct
gatgtgctggccgtacacctgctgctcaaagaagccggttgtccgttcccgatgccggtc
gcgccgctgttcgaaaccctcgacgacctgaacaatgctgacgatgtgatgaagcaattg
ctgagcatcgactggtatcgcggtttcattcagggcaaacagatggtgatgattggctat
tccgactccgcaaaagacgcgggcgtgatggcggcatcctgggcgcaatatcgcgcgcaa
gatgccctgatcaaaacctgcgagaaagccgggattgccctcacactgttccacggacgc
ggcggttctatcggccgtggcggcgcaccggcgcaagctgcgttgctgtctcagcctccg
ggcagcctgaaaggcggcctgcgcgttaccgaacagggcgagatgatccgcttcaaattc
ggtttgccggaggtcaccatcagcagcctggcgctgtacacctctgcgattctggaagcc
aacctgttaccaccgcctgagccgaaacaagcctgggtggatatcatggaacagctgtct
gacgtgtcctgcaaaatgtaccggggttatatccgcgagaataaagacttcgtgccttat
ttccgcgccgcaacaccggaacaggaactggcgaaactgcctctgggttcacgcccggcg
aaacgtaaagccagcggcggcgttgaaagcctgcgagctattccgtggattttcgcctgg
acgcaaaaccgtctgatgctgccagcctggctgggtgccggtgccggtttgcaggctgtg
gtcgatggcgggaaacgtgacgagctggaaaccatgtgtcgcgactggccgttcttctcc
acccgaatcggcatgctggaaatggtgtttgcgaaagcggacctgtggctggcggaatac
tacgatcatcgtctggtagagaaagagctgtggccgctcggtcagcagttgcgcgatcag
ctggcaagcgacatcaaagtgattctggcgatttctaacgacgatcacctgatggaagat
ttgccatggattgcggaatctatcgccctgcgtaacgtctacactgacccgctgaatgta
ttgcaggctgaactgctgcaccgttcccgcgagctggaaaaagacggcaagcaggatgct
aacgtcgaacaggcgttgatggtaacgattgctggcgtggcagcaggtatgcgtaatacc
ggctag

DBGET integrated database retrieval system