KEGG   Riemerella anatipestifer RA-GD: RIA_1864Help
Entry
RIA_1864          CDS       T02007                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
rar  Riemerella anatipestifer RA-GD
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rar00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RIA_1864
  Amino acid metabolism
   00310 Lysine degradation
    RIA_1864
   00380 Tryptophan metabolism
    RIA_1864
Enzymes [BR:rar01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     RIA_1864
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1858388..1861147
Genome map
AA seq 919 aa AA seqDB search
MDKFSFLNATHADFIDSMYQQYLKYPDSLEPSWKAFFQGFDFALENFGEDDSFTEKVGAS
SLSQQVGVPDDIIKEFKVLNLIEAYRTRGHLFTRTNPVRERRTYLPDLSIENFGLSKSDL
DTKFNSATETGMLGAATLADIIRHLDQIYCDSIGIEYMHIREVEEKEFIRQWISKNENHP
ELSADEKIQILSKLNQAVAFENYLHTKFVGQKRFSLEGGESLIPALDQLISRSSKHGVDE
VVLGMAHRGRLNVLTNIFGKSYKQIFSEFEGKEFEEDVFSGDVKYHLGSTTKIKTAAGEE
VIINLTPNPSHLETVASLVQGISRAKIDHTYGNNFKKVLPIVIHGDAAIAGQGIVYEIAQ
MMTLDGYKTGGTVHIVVNNQVGFTTNYLDARSSTYCTDIAKVTDSPVMHVNADDVEAVVH
AIRFAADYRAAFGKDVYIDLLGYRKYGHNEGDEPRFTQPKLYNTIAKHPNPREIYKVKLE
KEGVLSEGVLKKMEEEFKTLLDKDFDASKEIQKNTLDVFMEQVWIKYLDPANKQKVLKAV
ETQYNAEQLKELAVKMSSLPKDKAFIRKITRLFEQRLKMIEEDKLDWAMAELLAYATLLA
EGYNVRISGEDVERGTFSHRHAVVKTEDAEEEYVPLQHINESQQFHIYNSLLSEYAVLGF
DYGYAMASPDTLTIWEAQFGDFVNGAQIIVDQYLVAAEEKWKLQNGLVMLLPHGSEGQGA
EHSSARLERFLTLCANNNIFVANCTVPANYFHLLRRQMKFPFRKPLVVMTPKSLLRHPKV
ISSMEELANGSFQPVIDDATADASKVERLVMCSGKVYYDLLAKKEELGDEKVALVRLEQL
YPLDSEKIETVLSKYSNRKDFVWVQEEPENMGAWSYILRNFRKYDVQVIAPVPSGTPAPG
SHKKYEINQTNVINQTFGI
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
atggataaattttcattcttaaatgcaacacatgctgatttcatagatagcatgtaccag
cagtacttaaaatacccagatagtttagagccatcttggaaagctttttttcaagggttt
gattttgctctagaaaattttggtgaagacgattcttttacagaaaaagtaggtgcgtct
tctttatctcagcaagtaggtgtcccagatgatattataaaggagtttaaagttcttaac
ttaatagaggcttatagaactagaggtcatttgtttactagaactaaccctgttagagag
agaagaacttatctccctgatttatctatagagaattttggattatcaaagtcagattta
gatactaaatttaactctgctacagaaacaggaatgctgggagctgctactttggcagac
attattcgtcatttagaccaaatttattgcgactctatcggtatagaatatatgcatatt
cgtgaggtggaggagaaggaatttattcgccagtggatttctaagaatgaaaatcaccca
gaactttcggcagacgaaaaaatacagattttatctaagctcaatcaagcggtagcattt
gaaaactatcttcatactaaattcgtaggacaaaagagattttcactggaaggaggagag
tctttaatccctgctttagaccagcttattagtcgttcttcaaaacatggtgtagatgaa
gtggttttgggtatggcacacagagggaggcttaatgtattaactaatatctttgggaaa
tcatacaagcaaatcttctctgaatttgaaggtaaagaatttgaggaagatgtattttct
ggagatgttaagtatcacttaggttctactacgaaaataaaaacggctgcaggagaagag
gtaattatcaatttaacgcctaacccgtctcacttagaaactgtagcttctttagtacaa
ggtatttctagagctaaaatagaccatacttacggtaataattttaaaaaagtattaccg
attgttatccatggagatgcagctattgcaggacaaggaattgtctacgagattgcacaa
atgatgactttagacggctacaagacaggaggaacggttcatattgtagttaataatcag
gtaggatttacaaccaactatctagatgcgaggtcttctacttattgtacggatattgct
aaggtaacagactcgcctgtgatgcatgtaaatgcagatgatgtagaggctgtggtacat
gcaattagatttgcggcagattatagagcagcgtttggcaaagatgtttatatagatttg
ttaggatacagaaagtacggacataacgaaggtgatgagcctcgttttacgcagcctaaa
ctttataataccattgcgaaacaccctaatcctagagaaatatataaagtaaaactagag
aaagaaggagtgctttctgaaggagtgttgaagaagatggaggaagaatttaaaaccctt
cttgataaagattttgatgcatctaaagaaattcaaaaaaatactttagatgtatttatg
gaacaggtttggattaagtatctagaccctgcaaataaacaaaaagttctaaaggctgta
gaaactcaatacaatgctgaacagttaaaagagttggcagttaagatgtcttctttacct
aaagacaaggcgttcataagaaaaatcactagactttttgaacaaaggctaaaaatgata
gaagaggataagttagattgggcaatggcagaacttttagcttatgctacgcttcttgca
gaagggtacaatgtgagaatttctggggaagatgtggagagaggtactttctctcaccgt
catgcagtggtaaaaacagaagatgcagaggaggaatatgtaccattacaacatatcaac
gaaagtcagcagtttcatatttataactcattactatcagagtacgctgttttagggttt
gattatggttatgctatggcatcgcctgatactttaaccatttgggaagcacagtttgga
gatttcgtgaatggcgctcaaattattgtggaccaatatttggtagctgcagaagaaaaa
tggaagctgcaaaatggtttggtaatgttgttacctcacggctctgaagggcaaggtgca
gaacactcttcggctaggttagagagatttttaacgctttgtgctaataataatattttc
gtagctaactgtacagttccagccaattatttccatttattgagaaggcaaatgaagttt
ccgtttagaaaaccgttagtggtaatgacacctaagtcgttactaagacaccctaaggtt
atttcttctatggaagagttagcaaacggaagtttccaaccagtgattgatgatgctacg
gctgatgcttctaaggtggagagattagtgatgtgttctggtaaggtttactacgattta
ttggctaaaaaagaggaattgggagatgagaaagtagctttagtaaggctggagcagtta
tatcctttggattcagagaaaatagagactgtgttgtctaaatattctaacagaaaagat
tttgtatgggttcaagaagagccagagaatatgggagcttggtcttatattttgagaaat
ttccgcaagtatgatgtacaagtaattgcaccagttcctagtggaacgccagcaccaggt
agccataagaagtatgagattaaccaaactaatgtaattaaccaaacatttggtatctag

DBGET integrated database retrieval system