KEGG   Riemerella anatipestifer CH3: M949_1264Help
Entry
M949_1264         CDS       T03250                                 

Definition
(GenBank) superoxide dismutase copper/zinc binding protein
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
rat  Riemerella anatipestifer CH3
Brite
Enzymes [BR:rat01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     M949_1264
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu CHRD
Motif
Other DBs
NCBI-ProteinID: AIH02433
LinkDB All DBs
Position
1285387..1285887
Genome map
AA seq 166 aa AA seqDB search
MKKLSLLLGSVLVLTSCVTSKTYTIQSKSNTDTKGTATFTQKAKTVILNIDVYNLTPGKH
AIHIHEFGDCSAKDGSSAGGHWNPTGHHHGKWDTEHFHMGDIGNLNADKNGHATLTFSTD
KWCLGCKDETKNLYNKSIIIHAGEDDYRTQPTGNAGGRVGCVEIKE
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactaagtttgttattaggaagtgttttagttttaacctcttgtgttacaagc
aaaacttacactatacagtctaaaagtaataccgatacaaagggtactgctacttttacc
caaaaagctaaaacggttattttgaatatagatgtttacaacctaacgcctggtaaacat
gccattcatattcacgagtttggagattgctcagctaaagacggttcttctgctggtgga
cactggaaccctacaggacatcaccacggaaagtgggatactgaacatttccacatggga
gatataggaaacctcaatgccgataaaaacggacatgcaacgcttacatttagtacagat
aaatggtgtttgggctgtaaagacgaaactaaaaacctttacaataaatctattatcatc
cacgctggagaagatgattatcgtactcaacccacaggtaatgcaggtggaagagtgggc
tgtgtagagataaaggaataa

DBGET integrated database retrieval system