KEGG   Riemerella anatipestifer CH3: M949_2039Help
Entry
M949_2039         CDS       T03250                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, e1 subunit
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
rat  Riemerella anatipestifer CH3
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rat00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    M949_2039
  Amino acid metabolism
   00310 Lysine degradation
    M949_2039
   00380 Tryptophan metabolism
    M949_2039
Enzymes [BR:rat01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     M949_2039
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
2077152..2079860
Genome map
AA seq 902 aa AA seqDB search
MYQQYLKYPDSLEPSWKAFFQGFDFALENFGEDDSFTEKVGASSLSQQVGVPDDIIKEFK
VLNLIEAYRTRGHLFTRTNPVRERRTYLPDLSIENFGLSKSDLETKFNSATETGMPGAAT
LADIIRHLDQIYCDSIGIEYMHIREVEEKEFIRQWIAKNENHPILSADEKIEILSKLNQA
VAFENYLHTKFVGQKRFSLEGGESLIPALDQLISRSSKHGVDEVVLGMAHRGRLNVLTNI
FGKSYKQIFSEFEGKEFEEDVFSGDVKYHLGSTTKIKTAAGEEVIINLTPNPSHLETVAS
LVQGISRAKIDHTYGNNFKKVLPIVIHGDAAIAGQGIVYEIAQMMTLDGYKTGGTVHIVV
NNQVGFTTNYLDARSSTYCTDIAKVTDSPVMHVNADDVEAVVHAIRFAADYRAAFGKDVY
IDLLGYRKYGHNEGDEPRFTQPKLYNTIAKHLNPREIYKAKLEKEGVLSEGVLKKMEEEF
KTLLDKDFDASKEIQKNTLDVFMEQVWIKYLDPANKQKVLKAVETQYNAEQLKELAVKMS
SLPKDKAFIRKITRLFDQRLKMIEEDKLDWAMAELLAYATLLAEGYNVRISGEDVERGTF
SHRHAVVKTEDAEEEYVPLQHINESQQFHIYNSLLSEYAVLGFDYGYAMASPDTLTIWEA
QFGDFVNGAQIIVDQYLVAAEEKWKLQNGLVMLLPHGSEGQGAEHSSARLERFLTLCANN
NIFVANCTVPANYFHLLRRQMKFPFRKPLVVMTPKSLLRHPKVISSMEELANGSFQPVID
DATADASKVERLVMCSGKVYYDLLAKKEELGDEKVALVRLEQLYPLDSEKIETVLSKYSN
RKDFVWVQEEPENMGAWSYILRNFRKYDVQVIAPVPSGTPAPGSHKKYEINQTNVINQTF
SI
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atgtaccagcagtacttaaaatacccagatagtttagagccatcttggaaagcttttttt
caagggtttgattttgctctagaaaattttggtgaagacgattcttttacagaaaaagta
ggtgcgtcttctttatctcagcaagtaggtgtcccagatgatattataaaggagtttaaa
gttcttaacttaatagaggcttatagaactagaggacatttgtttactagaactaaccct
gttagagagaggagaacttatcttcctgatttatctatagaaaattttgggttgtcaaag
tcagatttagaaactaaatttaattctgctacagaaacaggaatgccgggagcagctact
ttggcagatattattcgtcatttagaccaaatctattgcgactctatcggtatagaatat
atgcatattcgtgaggtagaggagaaggaatttattcgtcagtggattgctaaaaatgaa
aatcaccctatactttcggcagacgaaaagatagaaattttatccaaattaaatcaagcg
gtagcttttgaaaactatcttcataccaagtttgtggggcagaagagattttcactagaa
ggcggagaatctttaattccagccttggaccagcttatcagtcgttcgtcaaaacacggt
gtagatgaagtggttttaggtatggcacacagagggaggcttaatgtattaactaatatc
tttgggaaatcatacaagcaaatcttctctgaatttgaaggtaaagagtttgaggaagat
gtattttctggagatgttaagtatcacttaggttctaccacgaaaataaaaacggctgca
ggggaagaggtaattatcaatttaacgcctaacccgtctcacttggaaactgtagcttct
ttagtacaaggtatttctagagctaaaatagaccatacttatggtaataattttaagaaa
gtattgcctatcgttattcacggagatgcagctattgcaggacaagggattgtctatgag
attgcacaaatgatgactttagacggttacaagacaggaggaacggttcatattgtagtt
aataatcaggtagggtttacaaccaattatctagatgcaaggtcttctacttactgtaca
gatattgctaaggtaacagattcacctgtaatgcatgtaaatgcagatgatgtagaagca
gtggtacacgcaattagatttgcggcggattatagagcagcgtttggcaaagatgtttat
atagatttgttaggttatagaaaatatgggcataacgaaggtgatgaacctcgctttaca
caacctaaactttacaataccatagcgaaacaccttaatcctagagaaatctataaagca
aaattagagaaagaaggagtgctttctgaaggagtgttgaagaagatggaggaagaattt
aaaacccttcttgataaagattttgatgcatctaaagaaattcaaaaaaatactttagat
gtatttatggaacaggtttggattaagtatctagaccctgcaaataaacaaaaagttcta
aaggctgtagaaactcaatacaatgctgaacagttaaaagagttggcagttaagatgtct
tctttacctaaagacaaggcgttcataagaaaaatcactagactttttgatcaaaggtta
aaaatgatagaagaggataagctagattgggcaatggcagaacttttagcttatgctacg
cttcttgcagaaggttacaatgtgagaatttctggggaagatgtggagagaggtactttc
tctcaccgtcatgcagtggtaaaaacagaagatgcagaggaggaatatgtaccattacaa
catatcaacgaaagtcagcagtttcatatttataactcattactatcagagtacgctgtt
ttagggtttgattatggttatgctatggcatcgcctgatactttaaccatttgggaagca
cagtttggagatttcgtgaatggcgctcaaattattgtggaccaatatttggtagctgca
gaagaaaaatggaagctgcaaaatggtttggtaatgttgttacctcacggctctgaaggg
caaggtgcagaacactcttcggctaggttagagagatttttaacgctttgtgctaataat
aatattttcgtagctaactgtacagttccagccaattatttccatttattgagaaggcaa
atgaagtttccgtttagaaaaccgttagtggtaatgacacctaagtcgttactaagacac
cctaaggttatttcttctatggaagagttagcaaacggaagtttccaaccagtgattgat
gatgctacggctgatgcttctaaggtggagagattagtgatgtgttctggtaaggtttat
tacgatttattggctaaaaaagaagaattaggagatgagaaagtagctttagtaaggctg
gagcagttgtatcctttggattcagagaaaatagagactgtgttgtctaaatattctaac
agaaaagattttgtatgggttcaagaggagccagagaatatgggagcttggtcttatatt
ttgagaaatttccgcaagtacgatgtacaagtaattgcaccagttcctagtggaacgcca
gcaccaggtagccataagaagtatgagattaaccaaactaatgtgattaaccaaacattt
agtatctag

DBGET integrated database retrieval system