KEGG   Rhodospirillum centenum: RC1_0239Help
Entry
RC1_0239          CDS       T00785                                 

Gene name
cbbL2
Definition
(GenBank) ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit
  KO
K01601  
ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
rce  Rhodospirillum centenum
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Anoxygenic photosynthesis in purple bacteria
Brite
KEGG Orthology (KO) [BR:rce00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    RC1_0239 (cbbL2)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    RC1_0239 (cbbL2)
Enzymes [BR:rce01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     RC1_0239 (cbbL2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
228179..229597
Genome map
AA seq 472 aa AA seqDB search
MGKTYQAGVKEYRETYWDPNYTPKDSDILACFKVVPQPGVPREEAAAAVCAESSTATWTT
VWTDLLTDLDYYKGRAYAIEDVPGDDEAFYAFVAYPMGLFEEGSIVNVFTSLVGNVFGFK
AVRSLRLEDVRFPLWFVTTCDGPPHGIQVERDKLDKYGRPLLGCTIKPKLGLSAKNYGRA
VYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCQEAIEKAEAETGERKGHYLNVTAPNME
EIYRRAEYAKEIGSPIIMSDYLTIGWAAHSSLSRWCRNNGMLLHVHRAMHGVIDRNPRHG
INFRVLAKLLRLLGGDHLHSGTVVGKLEGDREATLGWVDLMRERHVKEDRSRGLFFDQEW
GHMAPVMPVASGGIHVWHMPALLSIFGDDAVFQFGGGTLGHPWGNAAGACANRVALEACV
EARNQGRDVEREGKDILTAAARHSPELKMAMETWKEVRFEFDVVDKLDVVHR
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagacctatcaggcaggcgtcaaagagtaccgtgagacctactgggacccgaac
tacacgccgaaggacagcgacatcctggcctgcttcaaggtggtcccgcagccgggggtc
ccgcgcgaagaagccgcagcggccgtctgcgccgaatcctccaccgcgacctggaccacg
gtctggaccgacctgctgaccgacctcgactactacaagggccgggcctacgcgatcgag
gacgtgccgggcgatgacgaggcgttctacgccttcgtggcctacccgatgggcctgttc
gaggagggctccatcgtcaacgtcttcacctcgctggtcggcaacgtcttcggcttcaag
gcggtgcgctccctgcggctggaggatgtgcgcttcccgctctggttcgtcaccacctgc
gacggcccgccccacggcatccaggtcgagcgcgacaagctggacaagtacggccgcccg
ctgctgggctgcacgatcaagccgaagctcgggctgtcggcgaagaactacggccgggcg
gtctatgagtgcctgcgcggcggcctggacttcaccaaggacgacgagaacgtcaactcc
cagcccttcatgcgctggcgcgaccgcttcctgttctgccaggaggcgatcgagaaggcc
gaggcggagaccggcgagcgcaagggccactacctgaacgtcacagcgcccaacatggag
gagatctaccgccgggccgagtacgccaaggagatcggctcgccgatcatcatgagcgac
tatctgacgatcggctgggcggcccattccagcctgtcgcgctggtgccgcaacaacggg
atgctgctgcacgtccaccgggcgatgcacggcgtcatcgaccgcaacccgcggcacggc
atcaacttccgggtcctggccaagctgctgcgcctgctgggcggcgaccacctgcattcc
ggcaccgtcgtcggcaagctggaaggcgaccgcgaggcgacgctcggctgggtggacctg
atgcgcgagcgccatgtgaaggaggatcgcagccgcggcctcttcttcgaccaggaatgg
ggccacatggcgccggtcatgccggtcgcttcgggcggcatccatgtctggcacatgccg
gccctgctctcgatcttcggtgacgatgccgtcttccagttcggcggcggcacgctgggg
catccctggggcaacgctgccggcgcctgtgccaaccgcgtggcgctggaggcctgcgtc
gaggcgcgcaaccagggccgcgacgtggagcgcgagggcaaggacatcctgaccgccgcc
gcccgccacagccccgaactgaagatggcgatggagacctggaaggaggtccgcttcgag
ttcgacgtggtggacaagctcgacgtcgtccaccgctga

DBGET integrated database retrieval system