KEGG   Rhodospirillum centenum: RC1_0240Help
Entry
RC1_0240          CDS       T00785                                 

Gene name
ccbS2
Definition
(GenBank) ribulose bisphosphate carboxylase, small subunit
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
rce  Rhodospirillum centenum
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Anoxygenic photosynthesis in purple bacteria
Brite
KEGG Orthology (KO) [BR:rce00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    RC1_0240 (ccbS2)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    RC1_0240 (ccbS2)
Enzymes [BR:rce01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     RC1_0240 (ccbS2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
229629..229988
Genome map
AA seq 119 aa AA seqDB search
MSVMQDYPSRLSDPGSRKLGTFSYLPPLDATQIRRQVEYIVAKGWNPALEHTEPEHAASH
YWYMWKLPLFGETDVDRVLAEIEACRQANPGHHIRLIGYDNIKQSQGTSMVVHRAPVAR
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtgatgcaggactatccttcccgtctttccgatccgggcagccgcaagctcggc
accttctcctacctgccgccgctggacgcgacgcagatccgccggcaggtggagtacatc
gtcgccaagggctggaacccggccctggagcacaccgagcccgagcatgccgccagccac
tactggtacatgtggaagctgccgctgttcggcgagacggacgtggaccgcgtcctggcc
gagatcgaggcgtgccggcaggccaatcccggccaccacatccgcctgatcggctacgac
aacatcaagcagagccagggcaccagcatggtcgtccatcgggcgcccgtggcgcgctga

DBGET integrated database retrieval system