KEGG   Rhodospirillum centenum: RC1_0693Help
Entry
RC1_0693          CDS       T00785                                 

Gene name
tuf
Definition
(GenBank) translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
rce  Rhodospirillum centenum
Brite
Translation factors [BR:rce03012]
 Eukaryotic Type
  Elongation factors
   RC1_0693 (tuf)
 Prokaryotic Type
   RC1_0693 (tuf)
Mitochondrial biogenesis [BR:rce03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    RC1_0693 (tuf)
Exosome [BR:rce04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   RC1_0693 (tuf)
  Exosomal proteins of breast cancer cells
   RC1_0693 (tuf)
  Exosomal proteins of colorectal cancer cells
   RC1_0693 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
739538..740725
Genome map
AA seq 395 aa AA seqDB search
MAKAKFERTKPHCNVGTIGHVDHGKTSLTAAITKVLAKTGGATFTAYDQIDKAPEEKARG
ITISTAHVEYETTNRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPALVVFLNKMDMADPELVELVELEVRELLSSYGFPGDDIPVVKGSALCALED
RNPEIGEQAILELMRHVDAYIPQPERPKDRPFLMPIEDVFSISGRGTVVTGRVERGVIKV
GEEVEIVGMKPTVKTTVTGVEMFRKLLDQGEAGDNIGALLRGTKREDVERGQVLAKPGSI
TPHTKFEAETYILTKDEGGRHTPFFTNYRPQFYFRTTDVTGMVTLPEGTEMVMPGDNVRI
RVELIAPIAMDEGLRFAIREGGRTVGAGVVSKIIE
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaggcaaaattcgagcggacgaagccgcactgcaatgtcgggacgatcggtcac
gtcgaccacggcaagacgtcgctgacggcggcgatcacgaaggtgctggcgaagacgggc
ggagccacgttcacggcgtacgaccagatcgacaaggcgcctgaagagaaggcgcgcggt
atcacgatttcgacggcgcacgttgagtacgagacgacgaaccggcactacgcgcacgtg
gactgcccgggccacgccgactacgtgaagaacatgatcacgggcgcggcgcagatggac
ggtgcgattctggtggtttcggcggctgacggcccgatgccgcagacgcgcgagcacatt
cttctggcgcgtcaggttggtgttccggccctggtcgtgttcctgaacaagatggacatg
gcggatcctgagctggtcgagcttgtggagcttgaggtccgtgagcttctgtcgtcctac
ggtttcccgggcgacgacattccggtggtgaagggctctgcgctgtgcgcgctggaggac
cggaacccggagatcggcgagcaggcgatcctcgagctgatgcgccatgttgacgcctac
attccgcagccggagcgtccgaaggaccgtccgttcctgatgccgatcgaggacgttttc
tcgatctccggccgtggcacggtggtgacggggcgcgtcgagcgcggggtgatcaaggtc
ggtgaggaagtcgagatcgtcggcatgaagccgacggtgaagacgacggtgaccggcgtt
gagatgttccgcaagctgctcgaccagggcgaggctggcgacaacatcggtgcgctgctg
cgcggcacgaagcgcgaggatgtggagcgcggtcaggttctggcgaagccgggctcgatc
accccgcacacgaagttcgaggccgagacctacatcctgaccaaggacgagggcgggcgt
cacacgccgttcttcacgaactaccggccgcagttctacttccgcaccaccgacgtgacc
ggcatggtgaccctgccggagggcacggagatggtgatgccgggcgacaacgtccgcatc
cgggtcgagctgatcgccccgatcgccatggacgagggcctgcgcttcgccatccgcgag
ggcggccgcaccgtcggcgccggcgtcgtctccaagatcatcgagtag

DBGET integrated database retrieval system