KEGG   Methanocella arvoryzae: RCIX1968Help
Entry
RCIX1968          CDS       T00526                                 

Definition
(GenBank) predicted ATP-dependent DNA ligase
Organism
rci  Methanocella arvoryzae
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1109184..1110245
Genome map
AA seq 353 aa AA seqDB search
MLYICLSPQKKIFTYTRCAMNDLLSQLPPEERLNVLKAEQPEWTEPMLATLTHERFSSPD
WIFERKLDGERVLAFKRDGIVRLISRNKKPLNDTYPEVVDALLAQPEKSFVLDGEVVAFK
DGQTSFEALQRRIGISNPGEARSRGVEIFYYIFDILYLAGYDLTSLPLVIRKELLRRALV
YKDPLRYLDYRREHGEKYFGEACAVGWEGLLAKNANSVYEHRRSDSWLKFKCVNQQEFVI
GGYTEPKGKRICLGALLVGYYEGEKLLYAGKVGTGYTDETLRQLCQLMAPLERATSPFSG
GGWPDKEVHWLEPKLVAQIGFEEWTRYNRLRQPRFKGLRDDKEPEKVVREDKG
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgctttacatttgtttatcgccgcagaagaaaatcttcacatataccagatgcgctatg
aacgacttattatcacagcttccaccagaggaacggctaaatgttttaaaggctgaacag
cccgagtggacggagccgatgctggcgacacttacccacgagaggttttccagccctgac
tggatcttcgagaggaagcttgacggagagcgagttctggcctttaagcgtgacggcata
gttcggctgatatccaggaataaaaagccgttgaacgatacctatccggaagtggtagac
gccctcctggcacagcccgaaaaaagcttcgtcctcgacggcgaagtggttgctttcaag
gacgggcagaccagcttcgaggcactccagaggcggataggcatcagcaatcccggtgag
gcccgcagccggggcgttgagatcttttactatatcttcgacatactatacctggctgga
tatgacctgacttccctgccccttgtcataagaaaagaactgctcaggcgggctctcgtc
tacaaggatcccttgcggtatctggattatcgcagggagcacggcgagaagtacttcggg
gaggcttgcgccgtgggctgggagggactgctggctaaaaatgctaacagtgtctacgag
caccgccgctcagatagctggctcaagttcaagtgcgtcaatcaacaggagttcgtcatc
gggggctacaccgagccaaagggtaaacgtatctgcctcggagcactgctggtcggctat
tacgagggcgaaaagcttctgtacgcgggcaaagtaggcacaggctataccgacgagacg
ttgaggcagctgtgccagctgatggctcctcttgagcgggcaacgtcgccattctcaggt
ggcggctggcctgataaggaagtccactggctggagccgaagctcgtcgcccagatcggc
ttcgaggagtggacccgctataacaggctccggcagccaaggtttaagggcctgcgggac
gataaggagcctgaaaaagtagtccgggaggacaaaggatga

DBGET integrated database retrieval system