KEGG   Rhodobacter capsulatus: RCAP_rcc00578Help
Entry
RCAP_rcc00578     CDS       T01213                                 

Gene name
cbbS
Definition
(GenBank) ribulose bisphosphate carboxylase, small subunit
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
rcp  Rhodobacter capsulatus
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Anoxygenic photosynthesis in purple bacteria
Brite
KEGG Orthology (KO) [BR:rcp00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    RCAP_rcc00578 (cbbS)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    RCAP_rcc00578 (cbbS)
Enzymes [BR:rcp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     RCAP_rcc00578 (cbbS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(619502..619858)
Genome map
AA seq 118 aa AA seqDB search
MSTVQDYPSRLSRPESRKMGTFSYLPPMGEAEIRRQVEWIVKNGWNPGIEHTEPDFAAQI
YWYMWKLPMFGETDVDAILAELKACHEANPGHHVRLIGYDNFTQSQGANMIVYRGTAV
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgttcaggactacccctcccgcctctcgcgcccggaaagccgcaagatgggc
accttttcctatctgccgccgatgggcgaggccgagatccgtcgtcaggtcgagtggatc
gtgaagaacggctggaacccggggatcgaacataccgaacccgacttcgccgcgcagatc
tattggtacatgtggaaactgccgatgttcggcgaaaccgatgtcgatgcgatcctggcc
gagctgaaagcctgtcacgaagcgaaccccggccatcatgtccggctgatcggctatgac
aatttcacccaaagccagggcgccaacatgatcgtctatcgcggcaccgccgtctga

DBGET integrated database retrieval system