KEGG   Ricinus communis (castor bean): 11542325Help
Entry
11542325          CDS       T01087                                 

Gene name
rbcL, RCOM_ORF00051
Definition
(RefSeq) ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit
  KO
K01601  
ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Photorespiration
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    11542325 (rbcL)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    11542325 (rbcL)
Enzymes [BR:rcu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     11542325 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
CP
AA seq 475 aa AA seqDB search
MSPQTETKASVGFKAGVKDYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAE
SSTGTWTTVWTDGLTSLDRYKGRCYHIEPVAGEENQFIAYVAYPLDLFEEGSVTNMFTSI
VGNVFGFKALRALRLEDLRIPPAYTKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGL
SAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEAIYKAQAETGEIKGHYL
NATAGTCEEMIKRAVFARELGVPIVMHDYLTGGFTANTTLAHYCRDNGLLLHIHRAMHAV
IDRQKNHGMHFRVLAKALRMSGGDHIHAGTVVGKLEGERDITLGFVDLLRDDFIEKDRSR
GIYFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQFGGGTLGHPWGNAPGAVAN
RVALEACVQARNEGRDLAREGNEIIREAGKWSPELAAACEVWKEIKFEFPAMDTL
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgtcaccacaaacagagactaaagcaagtgttgggttcaaggctggtgttaaagattat
aaattgacttattatactcctgaatatgaaaccaaagatactgatatcttggcagcattc
cgagtaactcctcaacctggagttccgcctgaggaagcaggagctgcagtagctgctgaa
tcttctactggtacatggacaactgtgtggaccgatgggcttaccagtcttgatcgttat
aaaggacgatgctaccacattgagcccgttgccggagaagaaaatcaatttattgcttat
gtagcttaccccttagacctttttgaagaaggttctgttactaacatgtttacttccatt
gtgggtaatgtatttgggttcaaagccctacgcgccctacgtctggaggatttgcgaatc
cctcctgcttatacaaaaactttccaagggccgcctcatggcatccaagttgagagagat
aaattgaacaagtatggtcgccctctattgggttgtactattaaacctaaattggggcta
tccgctaagaattacggtagagcagtttatgaatgtctacgcggtggacttgattttacc
aaagatgatgagaacgtgaactcccaaccatttatgcgttggagagaccgtttcttattt
tgtgccgaagcaatttataaagcacaggctgaaacaggtgaaatcaaaggacattatttg
aatgctactgcaggtacatgcgaagaaatgatcaaaagggctgtatttgccagagaatta
ggagttcctatcgtaatgcatgactacttaacagggggattcactgcaaatactaccttg
gctcattattgccgagataatggtttacttcttcacattcaccgcgcaatgcatgcagtt
attgatagacagaagaatcatggtatgcattttcgtgtactagctaaggcgttacgtatg
tctggtggagatcatattcacgctggtaccgtagtaggtaaacttgaaggggaaagagac
atcactctgggctttgttgatttattgcgtgatgattttattgaaaaagatcgaagccgc
ggtatttatttcactcaagattgggtctctctacctggtgttctgcctgtagcttcaggg
ggtattcacgtttggcatatgcctgctctgaccgagatctttggagatgattccgtacta
caattcggtggaggaactttagggcacccttggggaaatgcacccggtgccgtagctaat
cgagtagctctagaagcatgtgtacaagctcgtaatgagggacgtgatcttgctcgcgag
ggtaatgaaattatccgcgaagctggcaaatggagtcctgaattagctgctgcttgtgaa
gtatggaaggagattaaatttgaattcccagcaatggatactttgtaa

DBGET integrated database retrieval system