KEGG   Ralstonia eutropha H16: H16_A1648Help
Entry
H16_A1648         CDS       T00416                                 

Gene name
h16_A1648
Definition
(GenBank) Glutathione S-transferase
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
reh  Ralstonia eutropha H16
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:reh00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    H16_A1648 (h16_A1648)
Enzymes [BR:reh01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     H16_A1648 (h16_A1648)
Transporters [BR:reh02000]
 Other Transporters
  Pores ion channels [TC:1]
   H16_A1648 (h16_A1648)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:1791873..1792478
Genome map
AA seq 201 aa AA seqDB search
MTMTLYYNPQSRASVARWMLEEVGAEYKLQHIDFTKGESRAPEFLAVNPMGKIPTLVLHD
GTVLTENGAIIAWLGDAFPQAGLMPPAGSSARGTVLRWLFFCGSCFEPALTDRMMRKEAP
LPKQAVGWGDYDDVIDAIEQALTPGPFVLGATFSAADIYLGASLAWAGRFGAPRISESAC
IQDYVKRITARDAFVRAAEAQ
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgacgctctactacaacccccagagccgcgcctcggtggcgcgctggatgctg
gaggaggtcggggctgagtacaagctgcagcacatcgatttcaccaagggcgagagccgc
gcgccggagttcctggcggtcaacccgatggggaagattccaacgctggtcttgcatgac
ggcacggtcctgaccgagaacggcgcgatcatcgcctggctgggggatgcctttccgcag
gccgggttgatgccgcctgcaggctcgtccgcgcgcggcacggtgctgcggtggctgttc
ttctgcggcagttgcttcgaacccgcgctgactgaccggatgatgcgcaaagaggcgccg
ctgccgaagcaggcggtcggctggggcgactatgacgatgtgatcgacgccatcgagcaa
gccctgacgcccggccccttcgtgctcggcgcgaccttcagcgcggcggacatctatctc
ggtgcctcgctggcatgggcgggccgattcggtgcgccgcgcatcagcgagagcgcgtgc
atccaggactacgtcaagcggatcaccgcgcgcgacgcgttcgtgcgcgcggcggaggcc
cagtga

DBGET integrated database retrieval system