KEGG   Ralstonia eutropha H16: H16_A2921Help
Entry
H16_A2921         CDS       T00416                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
reh  Ralstonia eutropha H16
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:reh00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    H16_A2921 (ppc)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    H16_A2921 (ppc)
   00680 Methane metabolism
    H16_A2921 (ppc)
Enzymes [BR:reh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     H16_A2921 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:3154523..3157561
Genome map
AA seq 1012 aa AA seqDB search
MTQHAARPNGRRTAPAAKDQSPALGAAQGDANGASAAEPKRPASRSGTKRSPKPKLSIVS
SNGTTIAPTARRTADKDVPLREDIRFLGRLLGECLREQEGDAAFEVVETIRQTAVRFRRE
NDRAAGAELDRLLKRLSRDQTNQVVRAFSYFSHLANIAEDQHHNRRRRVHALAGSPPQAG
SLAHALEAIDAAGVTGKQLRKFLDEALIVPVLTAHPTEVQRKSILDAEREIARLLAERDL
PMTARERDHNTAQLRAKVTTLWQTRMLRDSRLTVADEIENALSYYRTCFLRGIPQLMSEL
EEDIAAVFPTTRKRKGTPGAQPAPLAPFLQMGSWIGGDRDGNPNVTAETLEHAASQQGQM
IIDWYLDEVHALGAELSMSTLMVDASPELLALAERSPDHSEHRADEPYRRALIGIYARLA
ATSKALTGHAVPRRPVAPAEPYDSAEAFAADVQVVVDSLRANHGQALANGRIEALARAIG
VFGFHLASVDMRQVSDVHEAVIAELFAAAGIAPDYAALPEARKLELLLAELRQPRLLTLP
WHEYSEQTRKELAIFAAARELRARYGKRIARNYIISHTETLSDLVEVMLLQKESGMLQGT
LGSKTDPARMELMVIPLFETIEDLRNAAGIMQSLLDLPGFDSVIAHHGVEQEVMLGYSDS
NKDGGFLTSTWELYKAELELVQLFEQRQVKLRLFHGRGGTVGRGGGPTYQAILSQPPGTV
NGQIRLTEQGEIINSKFANAEIGRRNLETVVAATLEASLLPQQNAPKDLDMFEAVMQQLS
DRAFTAYRDLVYETPGFKDYFFATTPITEIADLNLGSRPASRKLMDKKNRRIEDLRAIPW
GFSWGQCRLLLPGWYGFGSAVKSLLDTAPDDKARKLAVTTLRRMVKTWPFFSTLLSNMDM
VLAKTDLAVASRYAQLCDDAALRRTVFNRISKEWHLTCEMLTLVTGHQERLADNPLLARS
IKNRFAYLDPLNHLQVELLKRYRSGKDGDDIRVRRGIHLTINGVAAGLRNTG
NT seq 3039 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagcatgctgcgcgccccaacggccggcggaccgccccggctgcgaaagaccaa
agccctgccctcggcgccgcccagggtgacgcaaacggcgcatccgccgccgaaccgaaa
cgccccgccagccgcagcgggaccaaacgttcccccaagcccaagctttccatcgtgtcg
agcaacggaaccaccatcgcccccaccgcccgccgcaccgccgacaaggacgtgccgctg
cgcgaggacatccgcttcctgggccgcctgctgggcgaatgcctgcgtgaacaggaaggc
gacgccgccttcgaggtggtcgagaccatccgccagaccgcggtgcgcttccgccgcgag
aacgaccgcgccgccggcgccgagctggaccgcctgctcaagcgcctgtcgcgcgaccag
accaaccaggtcgtgcgcgcgttcagctatttctcgcacctggccaatatcgccgaggac
cagcaccacaaccgccgccgccgcgtgcacgcgctggccggctcgccgccgcaggcgggc
agcctggcccacgcgctggaggcgatcgacgccgccggcgtgaccggcaagcagctgcgc
aagttcctggacgaggccctgatcgtgccggtgctgaccgcgcacccgaccgaagtccag
cgcaagagtattctcgacgccgagcgcgagatcgcccgcctgctggccgagcgcgacctg
ccgatgaccgcgcgcgagcgcgaccacaacaccgcgcagctgcgcgccaaggtcaccacg
ctgtggcagacccgcatgctgcgcgattcgcgcctgacggtggccgacgagatcgaaaac
gccctgtcctactaccgcacctgtttcctgcgcggcatcccgcagttgatgagcgagctg
gaagaagacatcgccgcggtgttcccgaccacgcgcaagcgcaagggcactccgggcgcg
cagccggcgccgctggcgccgttcctgcagatgggttcctggatcggcggcgaccgcgac
ggcaaccccaacgtcaccgccgagacgctggagcatgccgccagccagcaggggcagatg
atcatcgactggtacctggatgaagtccatgcgctgggcgcggagctgtcgatgtcgacg
ctgatggtcgacgccagcccggaactgctggcgctggccgagcgctcgcccgaccactcc
gagcatcgcgccgacgaaccctaccgccgcgcgctgatcggcatctacgcgcgcctggcc
gcaaccagcaaggcgctgaccggccacgccgtgccgcgccgcccggtggcgccggccgag
ccctatgacagcgccgaggcctttgccgccgacgtgcaggtggtggtcgactcgctgcgc
gccaaccatggccaggcgctggccaatggccgtatcgaagcgctggcgcgcgccatcggc
gtgttcggtttccacctggcatcggtcgacatgcgccaggtctcggacgtgcacgaggcg
gtcatcgccgagctgttcgccgccgccggcatcgcccccgactacgccgccctgcccgag
gcgcgcaagctggaactgctgctggccgaactgcgccagccgcgcctgctgacgctgccg
tggcacgagtattccgagcagacccgcaaggaactggcgatcttcgccgccgcgcgcgag
ctgcgcgcgcgctatggcaagcgcattgcgcgcaactacatcatctcgcacaccgagacg
ctgtcggacctggtcgaagtgatgctgctgcagaaggaatccggcatgctgcagggcacg
ctgggcagcaagaccgacccggcgcgcatggagctgatggtgatcccgctgttcgagacc
atcgaggacttgcgcaacgccgccggcatcatgcagtcgctgctggacctgccgggcttc
gactcggtgatcgcgcaccatggcgtcgagcaggaagtgatgcttggctactcggactcg
aacaaggacggcggcttcctgacttccacctgggagctgtacaaggccgagctggagctg
gtgcagctgttcgagcagcgccaggtcaagctgcgcctgttccacggccgcggcggcacc
gtcggccgcggcggcggcccgacctaccaggccatcctgtcgcagccgccgggcacggtg
aacggccagatccgtctgaccgagcagggcgagatcatcaacagcaagttcgccaacgcc
gagatcggccggcgcaacctggaaacggtggtcgccgccacgctggaagcctcgctgttg
ccgcagcagaacgcacccaaggacctcgacatgttcgaggccgtgatgcagcagctgtcg
gaccgagccttcaccgcctaccgcgacctggtctacgagaccccgggcttcaaggactac
ttcttcgccaccacgccgatcaccgagatcgccgacctgaacctgggttcgcgcccggcc
tcgcgcaagctgatggacaagaagaaccgccgcatcgaagacctgcgcgcaatcccgtgg
ggcttctcgtggggccagtgccggctgctgctgccgggctggtacggcttcggcagcgcg
gtcaagtcgctgctggacaccgcgccggacgacaaggcgcgcaagctggccgtgaccacg
ctgcgccgcatggtcaagacctggccgttcttctcgacgctgctgtccaacatggacatg
gtgctggccaagaccgacctggccgtggcctcgcgctatgcccagctgtgcgatgacgcg
gccctgcgccgcaccgtgttcaaccgcatcagcaaggaatggcacctgacctgcgagatg
ctgacactggtcaccggccaccaggaacggctggcggacaacccgctgctggcgcgctcg
atcaagaaccgctttgcctacctcgacccgctcaaccacttgcaggttgagttgctgaaa
cgctaccgctcgggcaaggatggcgacgacatccgggtgcggcgcggcatccacctgacc
atcaacggggtcgcggcgggcctgcgcaatacgggctga

DBGET integrated database retrieval system