KEGG   Ralstonia eutropha H16: H16_A3491Help
Entry
H16_A3491         CDS       T00416                                 

Gene name
tufA
Definition
(GenBank) translation elongation factor EF-1alpha (EF-TU,GTPase)
  KO
K02358  
elongation factor Tu
Organism
reh  Ralstonia eutropha H16
Brite
Translation factors [BR:reh03012]
 Eukaryotic Type
  Elongation factors
   H16_A3491 (tufA)
 Prokaryotic Type
   H16_A3491 (tufA)
Mitochondrial biogenesis [BR:reh03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    H16_A3491 (tufA)
Exosome [BR:reh04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   H16_A3491 (tufA)
  Exosomal proteins of breast cancer cells
   H16_A3491 (tufA)
  Exosomal proteins of colorectal cancer cells
   H16_A3491 (tufA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:complement(3758985..3760175)
Genome map
AA seq 396 aa AA seqDB search
MAKEKFERTKPHVNVGTIGHVDHGKTTLTAAIATVLAAKFGGAAKKYDEIDAAPEEKARG
ITINTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLARQVGVPYIIVFLNKCDMVDDAELLELVEMEVRELLSKYEFPGDDTPIIKGSAKLALE
GDKGELGEVAIMNLADALDTYIPTPERAVDGTFLMPVEDVFSISGRGTVVTGRIERGVVK
VGEEIEIVGIKPTVKTTCTGVEMFRKLLDQGQAGDNVGLLLRGTKREDVERGQVLCKPGS
IKPHTHFTGEVYILSKDEGGRHTPFFNNYRPQFYFRTTDVTGSIELPKDKEMVMPGDNVS
ITVKLIAPIAMEEGLRFAIREGGRTVGAGVVAKILD
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggaaaagttcgagcggaccaagccgcacgtgaacgttggtacgattggtcac
gttgaccatggcaagaccacgctgaccgcagcgattgccacggtgctggcagccaagttt
ggcggtgccgccaagaagtacgacgaaatcgacgcagcgccggaagaaaaggcacgcggt
attaccatcaataccgcgcacgtcgagtacgaaacggccaaccgccactacgcgcacgtt
gactgcccgggccacgctgactatgtgaagaacatgatcacgggtgccgcccagatggac
ggcgcgatcctggtttgctcggctgctgacggcccgatgccgcaaacgcgtgagcacatc
ctgctggcccgccaggttggcgtgccgtacatcatcgtgttcctgaacaagtgcgacatg
gtggacgacgctgaactgctcgagctggtcgagatggaagttcgcgagctgctgtcgaag
tacgagttccccggcgacgacaccccgatcatcaagggttcggccaagctggcgctggaa
ggcgacaagggcgagctgggcgaagtggccatcatgaacctggccgacgcgctggacacc
tacatcccgacgccggagcgtgccgttgacggtaccttcctgatgcctgtggaagacgtg
ttctcgatctcgggtcgcggcaccgtggtgaccggccgtatcgagcgcggcgtggtgaag
gtcggtgaggaaatcgaaatcgtcggtatcaagccgacggtgaagaccacctgcaccggc
gtggaaatgttccgcaagctgctggaccagggtcaagccggcgacaacgttggcctgctg
ctgcgcggcaccaagcgtgaagacgtcgagcgcggccaggtgctgtgcaagccgggttcg
atcaagccgcacacccacttcaccggcgaggtgtacatcctgtcgaaggacgaaggcggc
cgtcacaccccgttcttcaacaactaccgcccgcagttctacttccgtaccaccgacgtg
accggctcgatcgagctgccgaaggacaaggaaatggtcatgccgggtgacaacgtgtcg
atcaccgtcaagctgatcgccccgatcgccatggaagaaggcctgcgcttcgctatccgc
gaaggtggccgtaccgtcggcgccggcgtcgtggcaaagatcctcgactaa

DBGET integrated database retrieval system