KEGG   Rhizobium etli bv. mimosae Mim1: REMIM1_CH00096Help
Entry
REMIM1_CH00096    CDS       T02778                                 

Gene name
gabT-1
Definition
(GenBank) 4-aminobutyrate aminotransferase 1
  KO
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
rel  Rhizobium etli bv. mimosae Mim1
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rel00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    REMIM1_CH00096 (gabT-1)
   00650 Butanoate metabolism
    REMIM1_CH00096 (gabT-1)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    REMIM1_CH00096 (gabT-1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    REMIM1_CH00096 (gabT-1)
Enzymes [BR:rel01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     REMIM1_CH00096 (gabT-1)
Amino acid related enzymes [BR:rel01007]
 Aminotransferase (transaminase)
  Class III
   REMIM1_CH00096 (gabT-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(102948..104228)
Genome map
AA seq 426 aa AA seqDB search
MTATSLTDRKNAAISRGVGMTTQIYADRAENAEIWDKEGRRYIDFAAGIAVLNTGHRHPK
VIAAVKDQLDRFTHTCHQVVPYENYISLAERLNVLVPGDFEKKTIFVTTGAEAVENAVKI
ARAATGRSAVIAFTGGFHGRTFMGMALTGKVVPYKVGFGAMPGDVFHIPFPVELHGVSVD
QSFAALKKLFAADVDPQRVAAIIIEPVQGEGGFYPVPASFMKALRELCDQHGILLIADEV
QTGFARTGRMFAMDHHEVAADLTTMAKSLAGGFPLAAVTGRAEIMDAPGPGGLGGTYGGN
PIGIAAAHAVLDVIKDEDLCNRANLLGQRLKQRLESLHERVPEIADIRGPGFMNAVEFND
RRTGLPSADFANNVRLAALDKGLILLTCGVHGNVIRFLAPITIQDDVFGEALDILETSML
EASAAC
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgacaagccttaccgaccggaagaacgccgcgatttcacgcggcgtcggcatg
accacccagatctatgcggaccgcgcagagaatgccgaaatctgggacaaggagggccgc
cgctatatcgatttcgccgccggaatcgcggtgctcaacaccggccaccgacaccctaaa
gtcattgcggcggtcaaggatcaactcgaccgcttcacccatacttgccatcaggtggtg
ccttatgagaactacatcagcctcgccgagcggctgaacgtgctggtgccgggggacttc
gagaagaagacgatctttgtcaccacgggcgccgaagccgtcgaaaacgccgtcaagatt
gcgcgggcggcaacgggccgctccgccgtgatcgcctttaccggcggctttcacgggcgc
accttcatgggcatggcgctgaccggcaaggtcgtgccctacaaggtcggcttcggcgcc
atgccgggcgatgtcttccatattcctttccccgtcgaactgcatggcgtctctgtcgat
cagtcgtttgcggcgctgaagaaactcttcgccgccgatgtcgatccgcagcgggtcgcg
gccatcatcatcgagccggtgcagggcgaaggcggcttctacccggtgccggcgagcttc
atgaaggcgctgcgcgaactctgcgaccagcacggcatcctgttgatcgccgatgaggtg
cagaccggttttgcccgcaccggccggatgtttgcgatggatcatcacgaggtggcggcc
gacctgacgacgatggcaaagagccttgccggcggctttccgcttgccgccgtcaccggt
cgcgccgagatcatggacgcgccgggaccgggcgggctcggcggcacctatggcggcaat
ccgatcggcatcgccgccgcgcatgccgtcctcgacgtgattaaggatgaagacctctgc
aaccgcgccaacctgctcggccagcggctgaagcagcggctggaatcgctgcacgagagg
gtgccggagatcgccgatattcgcggacccggcttcatgaacgccgtcgaattcaatgac
cggaggacgggattgccaagcgctgacttcgccaacaatgtgcggttggcagcgctcgac
aaggggctgatcctgctgacctgcggcgtccatggaaacgtcatccgcttcctcgcgcct
atcaccatccaggacgatgtctttggcgaggcgctcgatattctcgagacctcgatgctg
gaagcgagtgcggcctgctag

DBGET integrated database retrieval system