KEGG   Rhizobium etli bv. mimosae Mim1: REMIM1_PD00265Help
Entry
REMIM1_PD00265    CDS       T02778                                 

Definition
(GenBank) ATP-dependent DNA ligase protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
rel  Rhizobium etli bv. mimosae Mim1
Pathway
rel03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:rel00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    REMIM1_PD00265
Enzymes [BR:rel01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     REMIM1_PD00265
DNA repair and recombination proteins [BR:rel03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     REMIM1_PD00265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C CTK3_C
Motif
Other DBs
NCBI-ProteinID: AGS24876
UniProt: S5SBQ2
LinkDB All DBs
Position
pRetMIM1d:complement(288539..291187)
Genome map
AA seq 882 aa AA seqDB search
MASDKLSSYRSKRDFQKTAEPSGERSLKQSNRRRFVIQKHDATRLHYDLRLELDGVFKSW
AVTKGPSLDPHDKRLAVEVEDHPLDYGDFEGTIPKGQYGGGTVMLWDRGYWKPEGRKSPE
QALSKGDFKFTLEGERLHGSFVLVRMRNDRERSKRTNWLLIKHHDEFSVDENGASILEEN
VTSVASGRSMEMIAAGKGRKPKPFMVEGGKVQADAVWDSNHGLAAEERQSEASAGKRAGT
ATAVDLPDFIAPQLCEKVERPPGGDGWIHEIKFDGYRIQMRVLDGEVTLKTRKGLDWTAK
YPEIAEAASGLPDCILDGEICALDEQGAPNFAALQAALSEGKTASLVYFAFDLLYHGGED
LRSKPLIERKRRLQELLTEAGNDPRIRYVEHFETGGDAVLRSACKLSLEGIISKQADAPY
QSGRTESWAKSKCRAGHEVVIGAYAKTNGRFRSLLAGVFRGDHFVYVGRVGTGYGAKKVE
TLLPKLKALETARSPFTGIGAPKKQAEVVWVKPELVAEIEFEGWTADGLVRQAAFKGLRE
DKPAREVEAEPPVRPAKADIAEPVPRARQTPARRKGAKADVMGVLISNPDKPLWPDANGS
EPVTKEELAGYYEAVGDWMIDHIKGRPCSIIRAPDGIGGEQFFQRHAMPGQSNLLDLVKV
FGDKKPYLQIDRIEGLAAVAQIAAVELHPWNCEPGQPEVPGRLVFDLDPGPDVPFATVVA
AAREMRDRLEDLGLISFCKTTGGKGLHVVTPLAVNKRKPLSWPEAKAFAHDVCQQMARNN
PDLYLIKMTKSLRGGRIFLDYLRNDRMATAVAPLSPRARPGATVSMPLTWTQVKSDLDPK
RFTIRTVPALLSKSSAWKDYCEGQRPLEQAIKKLGRAGKHAA
NT seq 2649 nt NT seq  +upstreamnt  +downstreamnt
atggccagcgacaagctatcaagctatcgatcaaaacgcgattttcagaagaccgctgag
cccagcggcgagcggtccctcaaacagagcaaccgccgtcgctttgtcatccagaagcac
gatgcgacacgcctgcactacgacctgcggctcgagcttgatggcgtgttcaagagctgg
gccgtcaccaaagggccatcgctcgatccgcacgacaagcggctggcggtcgaggtcgag
gatcatcccctcgattatggcgacttcgaaggcactattccgaaaggccagtatggcggt
ggcacggtcatgctgtgggatcgcggctattggaagccggagggcaggaagagcccggag
caggcgctttccaagggtgatttcaagttcacgctcgaaggcgagcgcctgcacgggagc
ttcgtgctggtgcgcatgcgcaacgatcgcgagcgcagcaagcgtaccaattggctgttg
atcaagcatcacgacgagttctccgtggacgagaacggtgcttcgatcctcgaagaaaac
gtcacctcggtggcctcaggccgcagcatggaaatgatcgcagccggcaaggggcgcaag
ccgaaacccttcatggtggagggcggcaaggtccaggcggacgccgtctgggacagcaat
cacggactggccgccgaggagcggcagtcggaggcgagcgcgggaaagcgcgccggtact
gcgacggcggttgatcttccggatttcatcgcgccgcaactctgcgagaaggtcgagcga
ccgcctggcggggacggttggatccatgagatcaagttcgatggatatcgcattcagatg
cgcgtgctcgatggcgaagtcaccttgaagaccaggaaaggcctcgactggacggccaag
taccccgaaatcgccgaggcggcgtctgggcttccggattgtatcctcgatggcgagatt
tgcgctctcgacgagcaaggtgcgcctaacttcgcggcactccaggcggcgctatcggag
ggcaagaccgccagcctcgtctacttcgccttcgacctgctctatcacggcggcgaggat
ctccgctcgaagcccctgatcgagcgaaagaggcgattgcaggagctcctcaccgaggcc
ggcaacgatcctcggatccgctacgtcgaacacttcgagaccggcggtgacgccgtcctc
agatcggcatgcaagctctcgctggaaggcatcatctcaaaacaggcagatgccccctat
caatccggacgaacggaaagctgggcgaagtcgaaatgccgggcggggcacgaggtggtg
atcggcgcctacgccaaaaccaacggcaggtttcgttcccttctcgccggtgtttttcgc
ggcgatcattttgtctatgtcggccgtgtcggaaccggctacggcgccaagaaagtcgaa
acgttgcttccgaaactgaaggcgctggagacggcgagatcgcccttcacgggtatcggt
gctccgaagaagcaggccgaggtcgtctgggtaaagccggaacttgtcgccgaaatcgaa
ttcgaggggtggaccgcggacggtctcgtccgccaagcagccttcaaaggattgcgcgaa
gataagcctgctcgggaagtcgaggcggagccaccagtaagacccgccaaagcggacatc
gcggagccggttccgagagccaggcaaacacccgcgcgccgcaagggtgcgaaggctgat
gtcatgggagtgctcatctcaaacccggacaaaccattgtggccggatgccaacggcagc
gaaccggtcacgaaggaagaattggcgggctattacgaggcagtcggcgactggatgatc
gaccacatcaagggcaggccctgctctatcatccgcgccccggatggaattggcggcgag
cagttctttcagcgccatgcgatgccgggacaatcgaacctgctcgacctggtcaaggtg
ttcggggacaaaaagccatacctgcagatcgatcgcatcgaaggccttgccgcggtcgcc
cagatcgcagcggtcgaactccatccgtggaactgcgaacccggtcaaccggaagttcct
ggtcgtctggtattcgacctcgatcccgggcctgacgttccctttgccacggtcgttgcc
gctgcccgcgaaatgcgcgatcggctggaagacctcggactgatcagcttttgcaagacg
acgggcggcaagggcctgcatgtcgtgaccccgcttgcggtcaataagcgcaagccgctg
tcatggcccgaggcaaaggctttcgcgcatgacgtctgccagcagatggcccgaaacaac
cccgatctctaccttatcaagatgacgaagagcctgaggggcggtcgcattttcctcgat
tacctgcgcaatgatcgcatggcgacggccgtagcgccgctttctcctcgagcccgcccc
ggtgcgacggtatcaatgcctctgacgtggacgcaggtgaaatcagacctcgaccctaaa
aggttcacgatccgaaccgtacctgccttgctatcgaagtcgtccgcctggaaggattat
tgtgaggggcagcgtcccttggagcaggcgattaagaagctcggccgcgccggcaagcat
gccgcgtga

DBGET integrated database retrieval system