KEGG   Rhizobium etli bv. phaseoli IE4803: IE4803_PC00487Help
Entry
IE4803_PC00487    CDS       T03667                                 

Gene name
dadX
Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
rep  Rhizobium etli bv. phaseoli IE4803
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rep00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    IE4803_PC00487 (dadX)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    IE4803_PC00487 (dadX)
Enzymes [BR:rep01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     IE4803_PC00487 (dadX)
Peptidoglycan biosynthesis and degradation proteins [BR:rep01011]
 Precursor biosynthesis
  Racemase
   IE4803_PC00487 (dadX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
pRetIE4803c:complement(507530..508663)
Genome map
AA seq 377 aa AA seqDB search
MDSDILVSRARTATITQGATGYLTIDLAALGRNYSKLASMLAPVRAGAVVKADAYGLGAE
RVAQTLYDQGCRHFFVAQFVEAVRLRPALAEGAQIFVLNGLQPGNELACAESGIIPVLNS
LAQWRQWSATARRLKRSLPAVLQFDTGMSRLGFPWEERAELAAAIRDGVNVEILFIMSHL
ACADELESSQNGEQIAEMARIADEFPGFDISFANSGGVFLGDAYHGVLARPGIALYGGAP
NAGGNNPMEPVVRLDVAVVQTRTVPSGAKIGYGGAHVTRRQTRLATIAAGYADGLPRSLG
DRGAVYHKGIRLPIVGRVSMDSTTVDITALPEGALSLGSLVEVLGPNQTLDDVAGDAGTI
SYEILTGLGDRYDRQYC
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggatagcgatattttggtttcccgcgcacgcaccgctacgatcacgcaaggagccacg
ggctatctgacgatcgatcttgccgcgctcggccgcaattattcgaagcttgcatcgatg
ctggcgccggtccgcgcgggagccgtcgtcaaggccgatgcttatggcctcggcgccgag
cgggtcgcccaaacgctctacgatcaggggtgcaggcatttcttcgtcgcccagttcgtc
gaggccgtaaggctgcggccggcccttgctgagggtgctcagatattcgtgctgaacggc
ttgcagcccggcaacgagctcgcctgcgccgaaagcggcattattccggttctcaattcg
ctcgcgcagtggcggcaatggtcggcgaccgcgcgtcggctgaagcgcagcctgccggcc
gttctgcagttcgacaccggcatgtcgcggctcggttttccctgggaagagcgagccgaa
ttggcggcagccatccgcgacggcgtcaatgtcgaaatcctgttcatcatgagccacctg
gcctgcgccgacgagctggagagcagccagaacggcgaacagattgccgagatggcgcgc
attgccgatgaatttcccggcttcgatatctccttcgccaattccggcggcgtctttctc
ggcgatgcctatcatggtgtgctcgcccgcccgggcatcgccctttatggcggcgcaccg
aatgccggcggcaacaacccgatggaaccggtcgtcaggctggatgtcgcggtcgtgcag
acgcgcaccgtaccttcaggcgccaagatcggttatggcggcgcgcatgtgacgcgcagg
caaacccgcctcgccaccatcgccgccggttacgccgacggcctgccgcgcagtctcggc
gaccgcggcgccgtttatcacaagggcatccgtctgccgatcgtggggcgcgtgtcgatg
gacagcacgaccgtcgacatcacggctttgcccgaaggggcgctgagcctcggcagcctc
gtcgaagtgcttggtcccaaccagacgctcgatgacgtggctggcgatgccggaacgata
tcttacgaaatactaaccggtctgggcgatcgttacgacaggcaatattgctga

DBGET integrated database retrieval system