KEGG   Rhodococcus erythropolis PR4: RER_23890Help
Entry
RER_23890         CDS       T00881                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  
ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rer00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RER_23890
   00030 Pentose phosphate pathway
    RER_23890
   00051 Fructose and mannose metabolism
    RER_23890
   00052 Galactose metabolism
    RER_23890
  Energy metabolism
   00680 Methane metabolism
    RER_23890
Enzymes [BR:rer01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     RER_23890
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     RER_23890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
LinkDB All DBs
Position
2580038..2581069
Genome map
AA seq 343 aa AA seqDB search
MRIGILTGGGDCPGLNAVIRAVVRTSAGRYGSTVVGFRDGWRGLLEDRKVPLDSDDRINR
ILTRGGTILGTARVNPDKLRAGLDQIKQTLDDNGIDVLIPIGGEGTLTAASWLSESGVPV
IGVPKTIDNDIDCTDVTFGFDTALAVATDAIDRLHTTAESHQRVMLVEVMGRHAGWIALQ
AGLASGAHLTLVPEQPFDVDEVCAMVKKRFQRGDSHFICVVAEGAMPDPASMTLREGGID
EFGHKIFTGVAQQLGNEIERRIGKEVRTTVLGHIQRGGTPTPHDRILATRFGVHATDAAH
RGDFGQMVALHGTSIDLVPLAEATRKLKTVPKERYEEAAAFFG
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatcggaatcctcacgggcggcggcgactgcccgggcttgaacgcggtcatccgc
gccgtcgtacgtacgtcggccggtcgttacggcagtaccgtggtcggattccgggacggc
tggcgaggattgctcgaggaccgcaaggtcccgctcgactccgatgaccgcatcaaccgc
atcctcacccgcggcggcacgatcctcggcaccgctcgcgtgaaccccgacaaactccgt
gcgggcctcgatcagatcaagcagaccctcgacgacaacgggatcgacgtcctgatcccg
atcggcggcgaaggcacactcaccgcggccagttggctttccgagagcggcgtacccgtg
atcggtgtgcccaagacgatcgacaacgacatcgattgcactgacgtgactttcggtttc
gacaccgccttggctgtcgccaccgacgccatcgacaggctccacaccacggccgaatcg
caccagcgcgtcatgctcgtcgaggtcatgggccggcatgcgggctggatcgcgctgcaa
gccggactggcgtcgggggcacacctgactctggttccggaacagccgttcgacgtcgac
gaggtatgcgcgatggtcaagaagcgcttccagcgcggcgactcccacttcatctgcgtc
gtcgctgaaggcgcgatgcccgaccccgcgtcgatgaccctgcgcgaaggtggcatagac
gagttcggccacaagatcttcaccggcgtcgcgcagcagctcggaaacgagatcgagcgc
cgcatcggcaaggaagttcgcaccaccgtcctcggacacattcagcgcggcggcaccccg
acgccgcacgaccgcatcctcgccactcgcttcggcgttcatgccaccgacgcagctcac
cgcggagatttcggtcagatggtcgcgttgcacggaacgtccatcgaccttgttccgctc
gccgaggcgacccgcaaactcaagacggtgcccaaggagcgctacgaggaggcagccgca
ttcttcggctga

DBGET integrated database retrieval system