KEGG   Rhizobium etli CFN 42: RHE_CH02320Help
Entry
RHE_CH02320       CDS       T00317                                 

Gene name
gstch8
Definition
(GenBank) glutathione S-transferase protein
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
ret  Rhizobium etli CFN 42
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:ret00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    RHE_CH02320 (gstch8)
Enzymes [BR:ret01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     RHE_CH02320 (gstch8)
Transporters [BR:ret02000]
 Other Transporters
  Pores ion channels [TC:1]
   RHE_CH02320 (gstch8)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
LinkDB All DBs
Position
2417955..2418581
Genome map
AA seq 208 aa AA seqDB search
MAEELVFYTNPMSRGRIARWMLEEIGRPYRTELLTFGESMKAPEYLRVNPMGKVPAIRHG
NTVVTECAAICAYLAETFPEKGLAPRPEERARYYRWMFFAAGPLESAVTMKALGFEIPTE
RLRMAGCGGFGDVMNTLEMAVSGSTYVTGERFTAADVYVGAHIGWGLGFGSIEKRQAFVD
YFGRISQRDAYKRANALDDEAGKTMQAA
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggccgaagaattggtattctacacgaacccgatgtcgcgcggccgcatcgcgcgctgg
atgctggaggagatcggccggccctatcgcaccgaactcctgaccttcggtgaaagcatg
aaggcgccggaatatctccgtgtcaatccgatgggcaaggtgccggcaatccgccacggc
aacaccgtggtcactgaatgcgcggcaatctgcgcctacctcgccgagaccttcccggaa
aaggggctggccccaagaccggaggagcgcgcccgctattaccgctggatgttctttgct
gccggtccactggaatcggcggtgacgatgaaggcgctcggtttcgaaattccgacggag
cgcctgcgcatggccggctgcggcggtttcggcgacgtcatgaacacgctcgaaatggcc
gtttccggctcgacttatgtcaccggcgagcgcttcaccgccgccgacgtctatgtcggc
gcgcatatcggctggggcctcggcttcggttccatcgaaaaacgccaggcgttcgtcgat
tacttcggccgcatcagccagcgtgacgcctataagcgcgccaatgcactggacgacgag
gccggcaagacgatgcaggccgcctga

DBGET integrated database retrieval system