KEGG   Ralstonia eutropha JMP134: Reut_B4228Help
Entry
Reut_B4228        CDS       T00268                                 

Definition
(GenBank) trehalose synthase
  KO
K05343  
maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
reu  Ralstonia eutropha JMP134
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:reu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Reut_B4228
Enzymes [BR:reu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Reut_B4228
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     Reut_B4228
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2:868605..871970
Genome map
AA seq 1121 aa AA seqDB search
MKRLTEPANALLLNADPLWYKDAVVYQLHIKSFYDANGDGVGDFAGLLAKLDYLVDLGID
TIWLLPFYPSPRRDDGYDIADYRNVHPDYGTLAEARRFVGAAHARGIRVITELVINHTSD
QHPWFQRARKAKPGSAARRYYVWADNDQAYAGTRIIFCDTEKSNWSWDPVAGAYFWHRFY
SHQPDLNFDNPQVMNEVLSVMRFWLDIGVDGLRLDAVPYLVEREGTTNENLPETHTAIRH
IRSHLDSHYQGRVLLAEANMWPEDAQQYFGRSSTGDKGDECHMAFHFPLMPRMYMAIARE
DRFPITDIMRQTPELPTDCQWAIFLRNHDELTLEMVTSSERDYLWEVYASDRRARINLGI
RRRLAPLMERDRRRIELMNSLLFSMPGTPVIYYGDEIGMGDNIHLGDRDGVRTPMQWSPD
RNGGFSHADPERLVLPPLQGPLYGYEAVNVEAQARDPHSLLNWMRRMLALRRKHRAFGRG
TLRFLFPGNRKILAYLREYEGEHILCVANLSRAPQAVELDLSAFNGRVPVEMMGATPFPA
IGTLTYLLTLPPYGFYWFVLSEDAHPPAWHVSAPEQMPDQITLVLQNKGRPELTEAARRM
LNDEVLPPYIRRRRWFGAKDDSIQRATLAYMAPFTKGTTGEEIYLGEVEVRLSGGRTERY
QLPLGVLWDRESADSVSQLAHGLSMARVRQGSRVGLATDGFVLEPFAREVIRALRADAEL
QGPQETIRFRSEPGLSAVQPEQEEIQWMSAEQSNSSLAYNNTAVLKLVRRLSGGTHPEVE
MTRYLTAQGYPHSPPLLGEVVRTGADGVPHTLMMVQGYILNQGNGWDWTLDYLSRVIDDA
LPAQESADEFAEAMNGYATMAGTLGRRLAELHAVLARPTDDPAFAPRPATDAETRQWAEQ
AMAAITHALALLEKRAQNDPKSASKRFMADVDTLLKARDALPALVNRLAAAAPGSLQTRF
HGDFHLGQVLIAQNDTYLVDFEGEPGQPLDWRRRKTSPLRDVAGLLRSIDYAAATVGTDR
QERTHAELPPALAERRGGLLERFRETASDAFLGCYRRHMEASGTPWADNAQFQPLLDLFL
LERAAYEVEYEAANRVAWIDLPASGLARMVRKLMAGNLEAQ
NT seq 3366 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcctgaccgaacccgccaacgccctgctgctcaacgcggatccgctctggtac
aaggacgcggtggtctaccagcttcatatcaagtccttctacgacgcgaacggcgacggc
gtgggggacttcgcgggcctgctggccaagctggactacctggtcgacctcggcattgac
acgatctggctgctgccgttctacccgtctccgcggcgcgatgacggctacgacattgcg
gattaccgcaacgtgcatcccgactacggcacgctcgccgaagcccgccgcttcgtcggg
gctgcgcatgcgcgcggcatccgcgtcatcacggaactggtcatcaaccacacctcggac
cagcatccgtggttccagcgagcgcgcaaggccaagccgggctccgccgcgcgccgctac
tacgtgtgggccgacaatgaccaggcctatgccggcacccgcatcatcttctgcgacacc
gagaaatcgaactggagctgggaccctgtcgccggcgcgtacttctggcaccgcttctat
tcgcaccagcccgacctgaacttcgacaacccgcaggtcatgaacgaggtgctgtcggtc
atgcggttctggctggacatcggcgtggacgggctgcggctggacgctgtgccttacctc
gtcgaacgcgaaggcaccacgaacgagaacctgcccgagactcataccgcgatccggcat
atccgctcgcatctcgattcccactaccagggacgcgtgctgctcgccgaggccaacatg
tggccagaagatgcgcagcagtacttcgggcgcagcagcaccggcgacaagggcgacgaa
tgccatatggccttccacttcccgctcatgccgcgcatgtacatggccatcgcacgcgaa
gaccgcttcccgatcaccgacatcatgcgccagacgccggagctgccgaccgactgccag
tgggcgatcttcctgcgcaaccatgacgaactgacgctcgagatggtcaccagcagtgag
cgcgactacctgtgggaagtctatgcgtcggaccggcgcgcacgcatcaaccttggcatc
cggcgcaggctggcgccgctgatggaacgcgaccggcgtcgcatcgaactgatgaacagc
ctgctgttttccatgccgggcacgccagtgatctactacggcgacgagatcggcatgggc
gacaacatccaccttggcgaccgggacggcgtgcgcacgccgatgcagtggtcgcccgac
cgcaatggcggcttctcgcacgcggaccccgagcgcctggtgctgccgccgctgcagggc
cccctgtacggctacgaggccgtcaacgtcgaagcgcaggcgcgcgatccgcattcgctg
ctcaactggatgcgccgcatgctggcgctgcggcgcaagcaccgcgcgttcgggcggggc
acgctgcgcttcctgtttccgggaaaccgcaagatcctggcctatctgcgcgagtacgaa
ggcgagcacatcctgtgcgtcgcgaacctgtcgcgggcgccgcaggccgtggaactcgat
ctttcggccttcaacgggcgcgtgccggtggagatgatgggcgccacgccgttccccgcg
atcggcacgctgacctacctgctgacgctgcccccctatggcttctactggttcgtgctc
agcgaggatgcccatccgcctgcctggcacgtctcggccccggaacagatgcccgaccag
atcacgctcgtgctgcagaacaaggggcggcccgaactgacggaggccgcgcgccgcatg
ctcaacgatgaagtgctgccgccctatatccgccgccggcgctggttcggcgcgaaggac
gacagcatccagcgcgccacactcgcctacatggccccgttcaccaaaggcaccacaggc
gaggaaatctatctcggcgaagtggaagtcaggctttccggcggccgtaccgagcgctac
cagcttccgcttggggtgctgtgggaccgcgagagtgccgatagcgtgtcccagctggcg
cacgggctgtcgatggcgcgcgtacgccagggcagccgggtaggactggccacggatggc
ttcgtgctggaaccgttcgcgcgcgaggtcatccgcgcgctgcgtgcagacgccgaactg
caggggccacaggagaccatccgcttccgctccgagcccgggctgtccgcggtacagccc
gagcaggaggaaatccagtggatgtcagcggagcagtccaacagctcgctggcgtacaac
aacacggccgtgctcaagctggtgcggcgcctctccggcggcacacatccggaagtggag
atgacgcgctacctgacggcgcagggttatccgcattcccctcccctgctgggcgaggtg
gtccggaccggcgcggacggcgtgccccatacgctgatgatggtgcagggctacatcctg
aaccagggcaacggctgggactggacgctcgactacctcagtcgcgtgatcgatgacgcg
ctgcccgcgcaggaaagcgcggacgagttcgccgaagcgatgaacggctacgccaccatg
gccggcacgctcggccgacggctggccgagttgcatgcagtgctcgcgcgtcccaccgac
gatcccgcctttgccccgcggccggctaccgatgctgaaacgcggcagtgggccgagcag
gccatggcggctatcacgcatgcactggcattgctggaaaagcgcgcgcagaacgacccg
aaatccgcaagcaagcgcttcatggccgacgtcgatacgctgctgaaggcgcgcgacgcc
ctgcccgcactggtcaaccggcttgccgcagccgcgcccggcagcctgcagacacgattc
cacggcgacttccacctgggccaggtgctgattgcgcagaacgacacctacctggtggat
ttcgaaggcgagccgggtcagccactcgactggcgccggcgcaaaacctcgccactgcgc
gatgttgcggggctgctgcgttcgatcgactacgccgctgcgaccgttggcacggaccgg
caggaacgcacccacgcggagttgccgcccgcgctggcggagcgccgcggcggcttgctc
gaacgcttccgcgaaaccgccagcgacgccttcctgggctgctaccggcgtcatatggag
gcctccggcacgccgtgggccgacaacgcgcagtttcagccgctactcgatctgttcctg
ctggaacgcgctgcgtacgaagtcgaatatgaagcggccaatcgcgtcgcctggatcgac
cttccggccagcgggctcgcgcgcatggtgcgcaagctcatggccggaaacctggaggcg
caatga

DBGET integrated database retrieval system