KEGG   Ralstonia eutropha JMP134: Reut_B5079Help
Entry
Reut_B5079        CDS       T00268                                 

Definition
(GenBank) ATP-dependent DNA ligase LigD phosphoesterase module / ATP-dependent DNA ligase LigD polymerase module
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
reu  Ralstonia eutropha JMP134
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:reu00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    Reut_B5079
Enzymes [BR:reu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Reut_B5079
DNA repair and recombination proteins [BR:reu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Reut_B5079
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2:1817933..1820638
Genome map
AA seq 901 aa AA seqDB search
MAKTTRQTPDDTRGTRSTRTAEPARKRPADALGKYRQMRDFAATPEPGGTRQRARATPKA
KRAGTLSFVIQKHAARRLHYDFRLELDGTLKSWAVPKGPSLDPADKRMAVHVEDHPLDYA
GFEGVIPPGHYGAGTVIVWDRGIWVPDGDADAAYRAGKLKFELRGEKLHGHWTLVRMHGS
RQKEQDAWLLIKERDDAAVPASEFDVTEALPDSVLAGTSAARKTTGRRAATNATKPGNGA
KDSTKDSARTKPLPLPRRATAAALPLALSPQLATLVERAPPDADAWRYEIKFDGYRMLAR
IDGDDVRLFTRQGHDWTSRLKTLAREVRALGLPDGWLDGEIVVLGKHGETDFQALQNAFE
TSHVESIQYFVFDLPFYAGHDLRKAPLSERRALLRRLFENNTGTRLRFSEEFEAAPDEML
DAACRMKLEGVIGKRIDAPYVSTRSNTWIKLKCTQRQEFVIGGFTEPKGSRQGLGSLLLG
VHDSAGRLRYAGNVGTGFDTRSLASLREQLDAQRTDKAPFHELPSSIKGLWVRPRLVAEV
SFGSWTREGRVRHAVFHGLRSDKPASAVSVEKPAAPAGRKTAATTAARSAPATTRKGKPT
AANGKVAISHSERVIDTASGLTKGDLVRYYESAAPLMLPHLRGRPIAMVRAPAGVAGQQF
FQRHGDTLKIDGVNVLDPDLWPGHPALLEIVSEHALVAAAQLNVVEFHTWNANKRSMDRP
NRIIFDLDPGEGVPWPHMREAAALMKAWLDELGLASFLKTSGGKGLHVVVPLTPRAGWDE
VKEFAHGVVLHMAVTIPQRFVAKSGAGNRIGKIFIDYLRNGVGATTAAAFSARARPGLGV
SVPLAWDELDGLEASDQWTVANVAPRLDELARHDPWDTYADTRQTITRAATRLARAGRSK
P
NT seq 2706 nt NT seq  +upstreamnt  +downstreamnt
atggccaagaccacgcgccagacccctgacgacacccgcggcacgcgtagcacccgaact
gcggagcccgcgcgcaagcgcccggccgacgcgctcggcaagtatcgccagatgcgggat
ttcgcagccacgcccgaacccggcggcacgcgccagcgcgccagggcaacgccaaaggca
aagcgcgccggcaccttgtccttcgtcatccagaagcacgctgcgcggcggttgcattat
gacttccggctggaactcgacggcacgctgaaaagctgggccgtgccaaagggtccgagc
ctggaccccgccgacaagcgcatggcggtgcatgtggaagaccatccgctcgactatgcg
ggcttcgagggcgtgatcccgccgggccactacggcgctggcacggtgatcgtgtgggat
cgtgggatctgggtgcccgacggcgatgccgatgcggcctatcgcgccggcaagctcaag
ttcgagttgcgcggcgaaaagctgcatggccactggacgctggtgcgcatgcacggcagc
cggcagaaggagcaggatgcctggctgctgatcaaggagcgcgacgatgcggcggtgccc
gcatccgaattcgacgtgaccgaagcgctgcccgacagcgtgctggccggcacatcggcc
gcgcgcaagaccaccgggcgaagggccgctacgaacgctacgaagcccggcaacggcgcc
aaggacagcaccaaggacagcgccagaaccaagcccttgccgctcccacgtcgcgccact
gccgcagcactgccgctcgcgctgtcgccgcaactggccacgctggtcgagcgagcgccc
cccgatgccgatgcatggcgctacgagatcaagttcgacggctaccgcatgctggcccgt
atcgacggcgacgacgtgcgcttgtttacgcgccagggccacgactggacatcgcgcctc
aagacgctcgcgcgcgaagtgcgcgcgctcggattgcccgatggctggctcgatggggaa
atcgtcgtgctcggcaagcacggcgagaccgatttccaggccttgcagaatgccttcgag
acgtcgcacgtggaatcgatccagtacttcgtcttcgacctgccgttctatgccggccac
gacctgcgcaaggcgccgctgtccgaacggcgcgcgctgctgcggcgcctgttcgagaac
aacaccggcacacgcctgcgcttcagcgaggaattcgaagccgcccccgacgaaatgctc
gacgctgcctgtcgcatgaagctcgaaggcgtgatcggcaagcgcatcgacgcgccgtat
gtcagcacgcgcagcaacacgtggatcaagctcaaatgcacgcagcgccaggagttcgtg
atcggcggctttaccgagcccaagggcagccgccagggtctcggctccctgctgctcggc
gtgcacgacagcgccgggcgcctgcgttatgcgggcaatgtgggaacggggttcgatacg
cgctcgctggccagcctgcgcgaacagctggatgcgcagcgcacggacaaggcgcccttc
catgagctgccctcctcgatcaaggggctgtgggttcggccgcggctcgtggccgaggtg
tcgttcggatcgtggacgcgcgaaggccgcgtgcgccatgccgtgttccatggcttgcgc
agcgataaacccgccagcgcggtgtccgtggaaaagcccgccgcacccgccggccgcaag
acggcggccacaaccgcagccaggagcgcgccagccaccacacgcaagggcaaacccacg
gcggcgaacggcaaggtcgccatcagtcactcggagcgcgtcatcgataccgccagcggg
ctgaccaagggagacctggtgcgctactacgaaagcgcggcgccactgatgctgccgcat
ctgcgcggccgccccatcgccatggtgcgggcgccggccggcgtcgccggccagcagttt
ttccagcggcatggcgacacgctaaagatcgacggcgtcaacgtgctcgatccggacctg
tggccgggtcatccggcgctgctcgagatcgtctcggagcacgcactggtggccgcggcg
cagcttaatgtggtggagttccatacctggaatgccaacaagcgcagcatggaccggccc
aaccgcatcatcttcgatctcgaccccggggagggcgtgccgtggccgcacatgcgcgaa
gccgcggcgctgatgaaggcgtggcttgacgaactcgggctcgccagtttcctgaagacc
agcggcggcaagggcctgcacgtggtggtgccgctgacaccgcgcgcgggctgggatgag
gtcaaggagtttgcccacggtgtggtgctgcacatggccgtgacgattccgcagcgcttc
gtggccaagagcggcgcgggcaaccgcattggcaagattttcatcgattacctgcgcaat
ggcgttggcgccacgacggccgcggcattctccgcgcgggcgcgccccggcctgggcgtg
tcggttccgcttgcgtgggacgagctcgacgggctcgaggcctccgaccagtggaccgtc
gccaatgtggcgcctcgcctggacgagctggcacgccacgacccctgggacacttatgcg
gacacccgccagaccatcacgcgcgctgccaccaggctggctcgcgccggaaggagcaag
ccatga

DBGET integrated database retrieval system