KEGG   Rhizobium gallicum: RGR602_PC01553Help
Entry
RGR602_PC01553    CDS       T03539                                 

Gene name
cbbS
Definition
(GenBank) ribulose-bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
rga  Rhizobium gallicum
Pathway
rga00630  Glyoxylate and dicarboxylate metabolism
rga01100  Metabolic pathways
rga01120  Microbial metabolism in diverse environments
rga01200  Carbon metabolism
Module
rga_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:rga00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    RGR602_PC01553 (cbbS)
Enzymes [BR:rga01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     RGR602_PC01553 (cbbS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: AJD45579
UniProt: A0A0B4XC52
LinkDB All DBs
Position
pRgalR602c:complement(1649845..1650264)
Genome map
AA seq 139 aa AA seqDB search
MHITQGAFSFLPPLTDEQIARQAQYCIDKGWATSLEFTDDPHPRNTYWDMWGHPMFDNAD
AAALIMELNECRKVYGDRYIRLVAFDSSHGWESVRLSFIVNRPAQEPGFRLERQEAAGRR
LHYTTRSYAADRPAGERYG
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgcatatcacccagggagcattctcgttcctgccgccgctgacggacgagcagatcgcc
cggcaggcgcaatactgcatcgacaagggctgggcgacgagcctcgaattcaccgatgat
ccccatccccgcaacacttattgggacatgtggggtcacccgatgtttgacaatgcggac
gcagccgcgctgataatggagctgaacgagtgccggaaggtctatggcgaccgctatatc
cggctcgtcgccttcgacagcagccatggatgggagtccgttcgcctctcattcatcgtc
aatcgtcccgcgcaagagccaggattccggcttgagcggcaggaggcggccggcagacgg
ctccattacaccacgcgttcttatgcggcagaccggccggcgggagaacgttatggctga

DBGET integrated database retrieval system