KEGG   Rubrivivax gelatinosus: RGE_01690Help
Entry
RGE_01690         CDS       T01803                                 

Gene name
alr
Definition
(GenBank) alanine racemase Alr
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
rge  Rubrivivax gelatinosus
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rge00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    RGE_01690 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    RGE_01690 (alr)
Enzymes [BR:rge01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     RGE_01690 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:rge01011]
 Precursor biosynthesis
  Racemase
   RGE_01690 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(178076..179164)
Genome map
AA seq 362 aa AA seqDB search
MPRHIEALVHVSALAHNLQRARAQAPDARVWAVVKANAYGHGIERAYDGLRGADGFALLD
LAEAERLRTLGWRGPILLLEGVFEPRDLELCSRLDLWHAVHCDEQIDWLAAHKTHRPHRV
FLKLNSGMNRLGFTPAAFRGAWARLGALPQVDEISAITHFSDADGPRGIAHQIAAFETAT
QDLPGERCLSNSAALLRHGVKNDWVRAGILLYGSAPDFPEHDIAHWDLQPTMTLRSRIIA
TQTLAAGDTVGYGSSFTAPGPMRVGIVACGYADGYPRLCPTGTPALVDGRRTRTIGRVSM
DMLEVDLTELPDAGIGSEVTLWGRGPGGSVLPIDEVARTAGTIGYELMCAVAPRVTMRVA
ED
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgccccgccacatcgaagctctcgtccacgtcagcgccctcgcccacaacctccagcgc
gcccgcgcgcaggcccccgatgcacgggtctgggcggtcgtcaaggccaacgcctacggc
cacggcatcgagcgcgcctatgacggattgcgcggcgccgacggcttcgcgctgctggac
ctggccgaggccgagcgcctgcgcacgctgggctggcgcggcccgatcctgctgctcgaa
ggcgtgttcgaaccgcgcgacctggagctgtgttcgcgcctggacctgtggcatgcggtg
cactgcgacgagcagatcgactggctggcggcgcacaagacgcaccgcccgcaccgcgtc
ttcctcaagctcaacagcggcatgaaccggctgggcttcacgccggcggccttccgcggc
gcctgggcacggctgggcgcgctgccgcaggtcgacgagatctcggcgatcacgcacttc
tccgacgccgacggcccacgcggcatcgcccaccagatcgccgccttcgagaccgcgacg
caggacctgccgggcgaacgctgcctgtccaacagcgccgcgctgctgcgccacggcgtg
aagaacgactgggtgcgcgccgggatcctgctgtacggcagcgcgcccgacttccccgag
cacgacatcgcccactgggacctgcagccgacgatgacgctgcgctcgcgcatcatcgcc
acgcagacgctggccgccggcgacaccgtcggctacggcagcagcttcaccgcgccgggg
ccgatgcgcgtgggcatcgtcgcctgcggctacgccgacggctacccgcggctgtgcccc
accggcacgccggcgctggtcgacggccggcgcacgcgcaccatcggccgcgtctcgatg
gacatgctcgaggtcgacctcaccgaactgcccgacgccggcatcggcagcgaagtcacg
ctctggggccgcggcccgggcggcagcgtgctgccgatcgacgaggtggcacgcaccgcc
ggcacgatcggctacgagttgatgtgcgccgtcgcgccgcgcgtgacgatgcgcgtcgcc
gaggactga

DBGET integrated database retrieval system