KEGG   Rubrivivax gelatinosus: RGE_39570Help
Entry
RGE_39570         CDS       T01803                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
rge  Rubrivivax gelatinosus
Pathway
Thiamine metabolism
Folate biosynthesis
Metabolic pathways
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rge00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    RGE_39570
   00790 Folate biosynthesis
    RGE_39570
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RGE_39570
Enzymes [BR:rge01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     RGE_39570
Exosome [BR:rge04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RGE_39570
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rge00537]
 Enzymes
  RGE_39570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
4251750..4253561
Genome map
AA seq 603 aa AA seqDB search
MRHTPFHLAAGVAAALLACAAQAQSIYPLNRADILAGSRFDFKVEFDGVVPRDQMKVSIN
GQDYAQVFGQNAEYIEREDGKPASSLLLRGVSLPTAGHYVVKASDGTHEKSVNWTVYGTP
AKRAAKNVILFIGDGFSIAHRTAARILSKGYDEGGKLKGKLAMDDMPYMALLSTQGTDSI
VTDSANSASAYTTGHKSCVNALGVYCSRAADTLAHPAVETITSLAKRRGMAVGAVTNSEV
EDATPAAMAAHTRRRSDFDDIVRMFLDSRIDVLMGGGSPHFLPKSTPGSKRKDDTDFIAA
YRQAGYQLATTKTEMTALAADKSTTKLLGLYNTGNVDGALDLKFLKKGSVAKFPDQPDVV
EEMRAAIEVLSRNPNGFVLMVESARIDKYSHSMDAERAIYDTIMLDDAVQAAKDWSKARG
NDTLILVTADHSHPVSLIGTVNDEAPGPEMRNKVGVYASAGWPNYPAPDAAGYPGTVDVS
RRLRFVFGAYPDHYDTFRPYLDGENVPAVKGKDGVVVANEQYKDVPGAVLRIGNLPNTGP
DAATQGIHSGDDVVLTATGPGAERVRGQMENTELFRVIAEALALAPQPAKAQPKARAKAA
TAQ
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgcgccacaccccgttccatctcgcagccggcgtcgccgccgcgctgctggcttgcgcc
gcccaggcgcaatcgatctacccgctgaaccgcgccgacatcctggccggctcgcgtttc
gacttcaaggtcgagttcgacggcgtcgtgccgcgcgaccagatgaaggtcagcatcaac
ggccaggactacgcccaggtcttcggccagaacgccgagtacatcgagcgcgaagacggc
aagcccgcgtccagcctgctgctgcgcggcgtgtcgctgcccacggccggccactacgtc
gtcaaggccagcgacggcacgcacgagaaatcggtgaactggacggtctacggcacgccg
gccaagcgtgcggcgaagaacgtcatcctgttcatcggcgacggcttctcgatcgcccac
cgcaccgcggcgcgcatcctgtccaagggctacgacgaaggcggcaagctcaagggcaag
ctggcgatggacgacatgccctacatggcgctgctgtccacgcagggcaccgactccatc
gtcaccgactcggccaactcggcctcggcctacaccaccggccacaagtcctgcgtcaac
gcgctgggcgtctactgctcgcgcgccgccgacacgctggcgcacccggccgtcgagacg
atcaccagcctggccaagcgccgcggcatggccgtcggcgcggtgaccaactccgaggtc
gaggacgccacgccggccgcgatggccgcgcacacgcgccgccggtcggacttcgacgac
atcgtgcgcatgttcctggacagccgcatcgacgtgctgatgggcggcggctcgccgcac
ttcctgcccaagtccacgcccggctccaagcgcaaggacgacaccgacttcatcgccgcc
taccgccaggccggctaccagctcgcgacgaccaagaccgagatgacggcgctggccgcc
gacaagagcacgaccaagctgctgggcctctacaacaccggcaacgtcgacggcgcgctg
gacctgaagttcctgaagaagggcagcgtcgccaagttccccgaccagcccgacgtcgtc
gaggagatgcgcgccgccatcgaggtgctgtcgcgcaacccgaacggcttcgtgctgatg
gtcgagagcgcgcgcatcgacaagtactcgcactcgatggacgccgagcgtgcgatctac
gacaccatcatgctcgacgacgccgtgcaggccgccaaggactggtccaaggcgcgtggc
aacgacacgctgatcctcgtcacggccgaccactcgcacccggtcagcctgatcggcacc
gtcaacgacgaagccccgggccccgagatgcgcaacaaggtcggcgtctacgccagcgcc
ggctggcccaactacccggcgcccgacgccgcgggctacccgggcacggtggacgtctcg
cgccgcctgcgcttcgtcttcggcgcctaccccgaccactacgacaccttccgcccctac
ctggacggcgagaacgtgccggcggtgaagggcaaggacggcgtcgtcgtcgccaacgag
cagtacaaggacgtgcccggcgccgtgctgcgcatcggcaacctgcccaacaccggcccc
gacgccgcgacgcaaggcatccactccggcgacgacgtcgtgctgacggccaccggcccc
ggcgccgaacgtgtgcgcggccagatggagaacaccgagctgttccgcgtcatcgccgag
gcgctggcgctggcgccgcagccggccaaggcccagcccaaggccagagcgaaagccgcc
accgcccagtga

DBGET integrated database retrieval system