KEGG   Rhizobacter gummiphilus: A4W93_14130Help
Entry
A4W93_14130       CDS       T04831                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
rgu  Rhizobacter gummiphilus
Brite
Enzymes [BR:rgu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     A4W93_14130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ARN20944
UniProt: A0A1W6L9R4
LinkDB All DBs
Position
3177756..3178337
Genome map
AA seq 193 aa AA seqDB search
MEHTLPALPYAQDALAPHLSKETLEYHYGKHHNAYVVNLNNLQKGTEFENLSLEDIIKKS
SGGIYNNAAQIWNHTFFWNSMKPNGGGEPKGALAAAIEAKFGSFAAFKEAFTKSAVGNFG
SGWTWLVKKPDGSVDIVNTGAAGTPLTTADKALLTIDVWEHAYYIDYRNLRPKFVETFLT
SLANWDFAEKNFA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggaacacaccctgccggcactgccgtatgcccaggacgccctggccccgcacctgagc
aaggaaacgctcgagtaccactacggcaagcaccacaacgcctacgtggtgaacctgaac
aacctgcagaagggcacggagttcgagaacctgtcgctcgaggacatcatcaagaagtcc
tccggtggcatctacaacaacgccgcccagatctggaaccacacgttcttctggaacagc
atgaagccgaacggcggtggcgagcccaagggcgcgctggccgcggccatcgaagccaag
ttcggcagcttcgccgccttcaaggaagccttcacgaagagcgccgtcggcaacttcggt
tccggctggacgtggctcgtgaagaagccggacggctcggtggacatcgtcaacacgggc
gccgccggcaccccgctgaccaccgccgacaaggcgctgctgaccatcgacgtgtgggaa
cacgcctactacatcgactaccgcaacctgcgcccgaagttcgtcgagacgttcctgacg
tccctcgccaactgggacttcgcggaaaagaacttcgcctga

DBGET integrated database retrieval system