KEGG   Rhodococcus jostii: RHA1_ro05108Help
Entry
RHA1_ro05108      CDS       T00382                                 

Definition
(GenBank) possible DNA ligase (ATP), N-terminal
Organism
rha  Rhodococcus jostii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
5444397..5445425
Genome map
AA seq 342 aa AA seqDB search
MASPAEELDVDGVAVRLSNPDKIYYPKLGAEGGTKRHLVEYYRTVALDGALLTALFDRPT
HLQRFPDGIEGEEIYQKRVPAKRPDHVESCEVTFPSGRKADVLRVRSAANIVWAANLGNI
TFHPWAVRCPDVDHPDELRIDLDPQPGTGFDDARAVALDVLRPLLDELGLVGYPKTSGGR
GLHVYLRIEPRWDFIEVRRAGIALAREIERRSGDRATTSWWKEERGERIFLDFNQNARDK
TIASAYSARKTPIATVSTPVTWEELVDVDPDDFTIATVPALLAKRGDPMGTMGDVAQSLD
VLLEMAERDAANGLGDLPYPPNYPKMPGEPKRVQPSRDRDRK
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggcgagtcctgccgaagaactcgacgtcgacggcgtcgccgtgcggctgtcgaacccc
gacaagatctactacccgaaactcggtgccgagggcggcacgaaacggcacctggtggag
tactaccggaccgtggcactcgacggtgcgctgctgaccgccctgttcgatcggccgacg
catctgcaacggttcccggacgggatcgagggcgaggagatctaccagaagcgggttccc
gcgaagcgccccgaccacgtggagtcgtgcgaggtcacgttcccgtccggccgcaaggcg
gatgtgctccgcgtgcgcagtgccgcgaacatcgtgtgggcggcgaacctcggcaacatc
acgttccatccgtgggcggtccggtgccccgacgtcgatcaccccgacgaactgcgcatc
gacctggacccgcagccgggaaccggattcgacgacgcccgggcggtcgcgctggacgtg
ctccggccgctgctcgacgaactcggtctcgtcggctaccccaagacgtcgggcggccgc
gggctgcacgtgtatctccgcatcgaaccgcgctgggatttcatcgaggtgcggcgcgcg
ggcatcgccctcgcccgggagatcgagcggcgcagcggcgaccgggccaccacgtcctgg
tggaaggaggaacgcggcgaacgcatcttcctcgacttcaaccagaacgccagggacaag
accatcgcgtccgcctactcggcccgcaagacgccgatcgcgaccgtgtcgacgcccgtc
acctgggaggaactggtggacgtcgaccccgacgacttcaccatcgcgaccgtgcccgcg
ctgctcgcgaagcgcggcgatcccatggggaccatgggtgacgtggcgcaatcgctcgac
gtgctgctggagatggccgaacgggacgccgcgaacggtctcggagatctgccgtaccca
cccaactacccgaaaatgccgggggaacccaagcgggtacaaccgagtcgggaccgagac
cgcaaatag

DBGET integrated database retrieval system