KEGG   Rhodococcus sp. B7740: NY08_3398Help
Entry
NY08_3398         CDS       T03776                                 

Definition
(GenBank) ATP-dependent DNA ligase clustered with Ku protein, LigD
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
rhb  Rhodococcus sp. B7740
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:rhb00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    NY08_3398
Enzymes [BR:rhb01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     NY08_3398
DNA repair and recombination proteins [BR:rhb03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     NY08_3398
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3509516..3511786
Genome map
AA seq 756 aa AA seqDB search
MATLEIDGRKVSVTNLDKVLFPETGTTKGNIIEYYVAIAPAMLPHLVGRAVTRKRWPNGV
DQSSFFEKNLAASAPDWLDRRSMQHSDRVVTYPLFSTAADLAWLGQQAAIEAHVPQWRFD
GTEAGPATRMVFDLDPGDDVDLARCAEVACEIRDLIGDIGMTAYPVTSGSKGIHLYVPLE
KPLSTSGASTVAKRVATLLEERSPDRVTATMAKAKRTGRVFVDWSQNNGKKTTVAPYSLR
GRALPTVAAPRTWDELEASGLQQLRFEEVLERFQDLGDLLAELDPTVDSAPESSSATDKL
VKYRSMRSADKTPEPIPTATEPQGNNDTFVIQEHHARRLHYDFRLEHDGVLVSWAVPKNI
PVDPKQNRLAVHTEDHPLEYASFSGRIPKGEYGGGDVSIWDSGTYELEKWREDEVIVVLH
GKKATGRFALIRTKGNQWLMHLMKDAPDKPEPKNISPMLATAGDILDLPDDEWSFEGKWD
GFRIIAELTHGSMTLRTRSGNDYTKKFGALQSFADDLAEHDAIVDGEVVVFDDDGVSSFE
KLQNATRDQIRFIAFDLLHLDGTSLLRKKYSDRRRLLELLTTGLDSVLVPPRLTGTAADA
IAESRERGWEGVVAKRTDSVYQPGKRAHTWIKHKNRRTQEIVIGGWRRGQGRRSGGFGSL
LMGIPDGDGLRYVGRVGTGFDDRALDTLAALLAPLEASDSPFSSVLPAADRNGAVWVEPV
LVGEVRYYEATESGHLRHPSWRGLRPDKEPKAVHRE
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atggccaccctcgagatcgatggtcgcaaggtctccgtcaccaacctcgacaaagtgctg
ttccccgaaacggggaccaccaagggcaacatcatcgagtactacgttgccatcgcgcct
gcgatgcttcctcacctcgtgggccgagcggtgacccgtaagcgttggcccaacggcgtg
gaccagtcgtcgttcttcgagaagaacctcgccgcctccgcacccgactggctcgatcgg
cgttcgatgcagcattccgaccgcgtcgtcacctacccattgttctccactgcagccgat
ctggcctggctcggtcaacaggcggccatcgaagcgcacgtgccgcagtggcggttcgac
ggcaccgaagccggacctgccacccgcatggtcttcgacctcgatcccggcgacgacgtg
gatctcgcgcgatgcgccgaagtagcctgcgagataagggatctgatcggcgatatcggg
atgaccgcatatccggtaaccagcggcagcaagggaatccacctgtacgtgccgctcgag
aaaccgctgtcgacctccggcgcgtccacggtcgccaaacgtgttgccacgctgctcgaa
gagcgctcgccggaccgggtcacggccacgatggcaaaggcgaagcgaaccgggagggta
ttcgtggactggagccagaacaacggcaagaagaccacggtcgccccgtactctctccgt
ggacgagcgctccccacggtcgcggcaccacgcacctgggacgagctggaagcatcgggg
ctgcaacagcttcgattcgaagaggtcctcgagcgattccaggacctcggcgatcttctc
gcagagctggaccccaccgtcgactcggcacccgaaagtagttctgccacggacaaactc
gtcaagtaccgcagcatgcgtagcgccgacaagacccccgaaccgataccgaccgccacc
gaaccgcagggcaacaacgacacgttcgtgatccaggaacaccatgcccgacggctgcac
tacgacttccgactcgagcacgacggcgtcctggtctcgtgggccgtcccgaagaacatc
ccggtggacccgaagcagaaccggctggcggtacacaccgaggaccacccactcgaatac
gcgtcgttctccggtcggatacccaagggcgagtacggcggcggcgacgtctcgatctgg
gacagcggaacctacgaactcgagaaatggcgagaggacgaggtcatcgtcgttctgcac
ggaaagaaggcgaccgggcgcttcgccctgatccgcaccaagggcaatcagtggctcatg
catctgatgaaggacgcacccgacaagcccgagccgaagaacatctcgccgatgctcgcc
accgcgggcgacatcctcgatctcccggacgacgagtggtcgttcgagggcaagtgggac
gggttccgcatcatcgcagaactgacgcacggttcgatgacgctgcgcacgcgaagcggt
aacgactacaccaaaaagttcggcgcactccaatctttcgcggatgacctggccgagcac
gacgccatcgtcgacggagaagtcgtggtattcgacgacgacggggtcagtagcttcgag
aaactgcagaacgccacccgtgaccagatccgattcatcgcgttcgatctgcttcacctc
gacggcacgtcactgctgcgcaagaagtactcggatcgacgacggttgctcgaactactg
accaccggactcgactcggtgctggtgccaccgcggctgacggggaccgctgcggacgcc
atcgccgaaagcagagaacgaggctgggaaggcgtcgtcgccaaacgaaccgactccgtc
tatcaacccggcaagcgcgcccacacctggatcaagcacaagaaccggcggactcaggag
atcgtgatcggcgggtggcgtcgggggcagggtcgtcgttccggtgggttcggctcactc
ctgatgggcattcccgacggggacggattgcgatacgtagggcgcgtcggaaccgggttc
gacgaccgtgcgctcgacacgctcgctgccctcctcgcgccactcgaggcgtcggacagt
cccttctcctcggtgctgcccgcggccgatcggaacggagcggtgtgggtcgagccggtg
ctcgtcggcgaggtgcggtactacgaggccacggaatccggccatctgcggcatccgagc
tggcgcggtctccgcccggacaaggaaccgaaggcagtgcatcgggaatga

DBGET integrated database retrieval system