KEGG   Rhodanobacter denitrificans: R2APBS1_3293Help
Entry
R2APBS1_3293      CDS       T02495                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
rhd  Rhodanobacter denitrificans
Pathway
rhd00620  Pyruvate metabolism
rhd00680  Methane metabolism
rhd01100  Metabolic pathways
rhd01120  Microbial metabolism in diverse environments
rhd01200  Carbon metabolism
Module
rhd_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:rhd00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    R2APBS1_3293
  Energy metabolism
   00680 Methane metabolism
    R2APBS1_3293
Enzymes [BR:rhd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     R2APBS1_3293
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AGG90360
UniProt: I4WVR6
LinkDB All DBs
Position
complement(3473788..3476490)
Genome map
AA seq 900 aa AA seqDB search
MEPSREPEFLPPDGPLREDVSRLGAMVGRMLAEQGGDTFFARVEQVRTAAIRRRREGASV
EELAASLAGLDADDAEALARAFATYFQAVNTAERVHRIRRRRDYQREGSAPQPESLLDVL
GRLKAAGVGADELVGWLDRLWIEPVFTAHPTEAVRRSLLEKEQAIVASLIDGFDRERTPQ
ERREDDDRIYMALSAGWQTAEASPVRPSVQDEREHVDFYLAHPLYRIVPALYESLAQALQ
TTYGVAIKLPRLLRFASWVGGDMDGNPNVGADTIADCLDSQRALVLERYREDVATLARLL
SQTEGRVAASAALRARLADYRARFPAAAAQIRPRHADMPYRCLLQLVGARLALTGDESSD
GYPSSGELLDDLQLIADSLFQHRGVHAGAYAVERLLCRVRSFGFHLARLDVRQDSRVHDD
ALAALLADDGWAARQADERARQLRDYASGGARFAISHAEVVVALYDVFATLGNTRRRYGG
EAVGLYIISMARSAADVLAVLALARYGGLVQDDNVPLNIAPLFETVDDLKNAPATLRALL
DDPVYRRHLAARGDQQWVMLGYSDSGKDGGTLASRWGLQRAQVELLEVAHAASIQLAFFH
GRGGSASRGGARITPALMSSPRGAVAGVLRVTEQGEVIHRKYGIRALALRNLEQTVGAVL
RASLRPRVDEPREARWREQMDALAAASRKTYRAFVERDGFVDYFRTATPVDVIERMTLGS
RPASRRSMRGVQDLRAIPWVFAWTQCRSILPGWYGLGSALEQGVQQFGEAALAEMARDWP
FFANLLDDVEMVLAKCDLDIAEAFSKLSGALHEEFFGLIRDEFARTRHWLLRLKGSDALL
QGDPRLAASIRLRNPYVDPMSLLQVDLLQRWRAGEHTDDAVLQALVACVNGVSQGLQNTG
NT seq 2703 nt NT seq  +upstreamnt  +downstreamnt
gtggaacccagtcgcgaacccgagttcctgccgcccgacggcccgttgcgcgaggatgtc
agccgcctgggcgcgatggtcgggcgaatgctggccgagcagggcggcgacacattcttc
gcgcgggtcgaacaggtgcgcacggcggcgatccgccgtcgccgcgaaggtgcctcggtg
gaggaactggccgcctcgctggccggtctcgacgccgacgacgccgaagcgctggcgcgc
gcgttcgccacctacttccaggcggtgaacaccgccgaacgggtgcaccgcatccgtcgt
cgtcgcgactaccagcgcgagggcagcgcgccgcagccggaatcgctgctcgacgtgctg
ggccggctgaaggctgcgggcgtgggcgccgacgagctggtcggctggcttgatcggctg
tggatcgagccggtgttcaccgcgcacccgacggaggcggtgcgccgctcgctgctggag
aaggagcaggcgatcgtcgcctcgctgatcgacggcttcgaccgtgagcgcacgccgcag
gagcgccgggaggacgacgaccgcatctacatggcgctgtccgccggctggcagaccgcc
gaggcctcgccggtgcggcccagcgtgcaggacgagcgcgagcacgtggacttctacctg
gcccatccgctgtaccgcatcgtgccggcgctgtacgaatcgctggcgcaggcgctgcag
acgacctacggcgtggcgatcaagctgccgcggctgctgcgcttcgccagctgggtcggt
ggcgacatggacggcaaccccaacgtgggcgccgacaccatcgccgactgcctcgactcg
cagcgcgcattggtgctggagcgctaccgcgaggacgtcgccacgctggcgcgcctgctc
agccagaccgagggtcgcgtggcagcgtccgcggcgctgcgcgcgcggctggcggactat
cgcgcccgcttcccggccgccgcggcgcagatccgcccgcgccacgccgacatgccgtac
cgctgcctgctgcagctggtcggcgcgcggctggcgctgaccggcgacgaatcttcggac
ggttatccgtccagtggcgaactgctggacgacctgcagctgatcgccgacagcctgttc
cagcaccgcggcgtgcacgccggcgcctacgcggtggaacgcctgctgtgccgcgtgcgc
agcttcggcttccacctggcgcggctggacgtgcggcaggattcgcgcgtgcacgacgac
gcgctggccgcgctgctggccgacgatggctgggccgcgcgccaggctgacgagcgcgcg
cggcaattgcgcgattacgccagcggcggcgcacgcttcgcgatcagccatgccgaggtg
gtcgtcgcgctgtacgacgtgttcgccaccctcggcaacacccgccggcgttacggcggc
gaggcggtggggctgtatatcatcagcatggcgcgcagcgccgccgacgtgctggcggtg
ctggcgctggcgcgctacggcgggttggtgcaggacgacaacgtgccgctcaacatcgcg
ccgctgttcgagaccgtcgacgacctgaagaatgcgccggccaccttgcgcgccctgctc
gacgacccggtctaccgccgccacctcgcggcgcgcggcgaccagcagtgggtgatgctg
ggctattccgacagcggcaaggacggcggcacgctggcctcgcgctggggcctgcagcgc
gcccaggtggaattgctcgaggtggcgcatgcggccagcatccagctggcgttcttccac
ggccgcggcggctcggccagccgcggcggcgcgcgcatcacgccggcactgatgtcctcg
ccgcgcggcgcggtggccggcgtgctgcgggtgaccgagcagggcgaggtgatccatcgc
aagtacggcatccgtgcgctggcgctgcgcaacctggagcagaccgtgggtgcggtgctg
cgcgccagcctgcgtccgcgcgtagacgagccacgcgaagcgcgctggcgcgagcagatg
gacgccttggcggccgccagccggaagacgtaccgcgcgttcgtcgagcgcgatggcttc
gtcgactactttcgcactgccacgccggtcgacgtgatcgagcggatgaccctgggctcg
cgcccggccagccgccgcagcatgcgcggcgtgcaggacctgcgcgcgatcccgtgggtg
ttcgcgtggacccagtgccgctcgattctgcccggctggtacggcctgggcagcgcgctg
gagcagggcgtgcagcagttcggcgaagcggcgctggcggagatggcgcgcgactggccg
ttcttcgccaacctgctcgacgacgtggaaatggtgctggccaagtgtgacctggacatc
gccgaggcgttctcgaagctgtccggcgcgctgcacgaggaattcttcggcctgatccgc
gacgagttcgcgcgcacccgccactggctgttgcggctcaagggcagcgacgcgctgctg
cagggcgacccgcgcctggccgcctcgatccgcctgcgcaatccctacgtcgatccgatg
agcctgctgcaggtcgacctgctgcagcgctggcgcgcaggcgagcacaccgacgacgcc
gtgctgcaggccctggtcgcctgcgtcaacggcgtttcgcaagggctgcagaacaccggc
tga

DBGET integrated database retrieval system