KEGG   Sinorhizobium fredii NGR234: NGR_b07050Help
Entry
NGR_b07050        CDS       T00888                                 

Gene name
alr
Definition
(RefSeq) alanine racemase, catabolic
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rhi00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    NGR_b07050 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    NGR_b07050 (alr)
Enzymes [BR:rhi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     NGR_b07050 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:rhi01011]
 Precursor biosynthesis
  Racemase
   NGR_b07050 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
LinkDB All DBs
Position
pNGR234b:709238..710371
Genome map
AA seq 377 aa AA seqDB search
MNCHASHIQSWDADAVTGSSGHLTIDLAALQRNYRKLSAAVAPASAAAVVKADAYGLGAE
QVSKALHAQGCRHFFVAHLPEALKLRPLLPNDTHIFVLNGLQPGAEITCTNADVVPVLNS
LEQFRRWSFTAEKLGRVFPAVLQFDTGMSRLGVPPQERTALAAELKGCGNLEILFIMSHV
ACADEADKKQNADQLAEMRVIAAEFAGLDVCFANSGGVFLGGDYHGVLARPGIALYGGAP
TAGRYNPMEPVVRLEVAVIQTRTVPAGTRVGYGGAHVTSAKTRLATIAAGYADGLPRSLS
DCGAVFYDGVRLPIVGRVSMDSITVDITALPEGTLSLGSLVEVLGPHQTLEDVAEAAGTI
SYEILTSLGRRYERRYR
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaactgtcatgcttcgcatattcaaagttgggatgcagacgctgttacgggctcttca
ggccacctgaccattgatctcgccgccttacagcgaaactaccgcaagctttcagccgcg
gtcgcccccgcatcggccgccgctgtggtcaaggccgacgcgtatgggcttggcgccgag
caggtctccaaagcgcttcatgcgcagggctgccggcacttctttgttgcacatctccct
gaggcgctgaaactcagaccgcttctgccgaacgacacgcacatattcgtgctcaatggg
ctgcagccgggagcagagatcacttgcaccaatgccgacgtcgttccggttctcaactct
ctcgagcagttccggcggtggtccttcaccgctgagaagctcggacgcgtttttcctgcc
gttctgcagttcgacactggcatgtcgcgtctcggcgtacctccacaggaaagaaccgcg
ctcgccgccgaactcaagggctgcgggaacctcgaaatcctcttcatcatgagtcatgtc
gcctgcgccgacgaggccgacaaaaagcagaatgccgatcagctcgccgagatgcgcgtt
atcgccgccgagttcgcagggctcgatgtctgctttgccaattcgggcggcgtctttttg
ggcggggactatcacggcgtgctggctcgtcccggtatcgccctctacggcggcgccccc
actgccggcagatacaaccccatggagcccgtcgttcggctcgaggtcgctgtcatccaa
acaaggacggtccctgccggaacgcgtgtcggatacggcggtgcgcacgtgacctccgct
aagaccaggctcgctacaatcgctgcaggttacgccgacggtcttccccgcagtctcagt
gattgcggcgccgttttctacgatggcgttcgcctgccaatcgttggccgcgtctcgatg
gacagcatcacggtggatatcaccgccttgcccgagggcacgctttccctgggcagtctc
gtcgaggttctcggtccccatcagacgcttgaggatgtcgccgaagccgccggcacgatc
tcctacgaaatcctgaccagcctcggccggcgttacgaacgtcggtatcgctga

DBGET integrated database retrieval system