KEGG   Sinorhizobium fredii NGR234: NGR_c07300Help
Entry
NGR_c07300        CDS       T00888                                 

Gene name
sodB
Definition
(RefSeq) superoxide dismutase contains Mn
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
rhi  Sinorhizobium fredii NGR234
Brite
Enzymes [BR:rhi01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     NGR_c07300 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
LinkDB All DBs
Position
788025..788627
Genome map
AA seq 200 aa AA seqDB search
MAFELPNLPYDYDALAPYMSRETLEYHHDKHHLAYVTNGNKLAEEAGLSNLSVEEIVKKS
YGTNQPLFNNAGQHYNHIHFWKWLKKGGGGTSLPGKLDAAIKSDLGGYDKFRTDFIAAGT
GQFGSGWAWLSVKNGKLEISKTPNGENPLVHGASPILGVDVWEHSYYIDYRNARPKYLEA
FVDNLINWDYVLEMYEAAVK
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgaattgccgaaccttccctatgactacgatgcgctggcgccttacatgtcg
cgcgagacgctcgaataccatcacgacaagcatcacctcgcctatgtgacgaacggcaac
aagctcgccgaggaagccggcctctccaatctttcggtggaggaaatcgtcaagaagtcc
tacggcaccaaccagccgctcttcaacaatgccggccagcactacaaccacatccacttc
tggaagtggttgaagaagggcggcggcggcaccagcctgccgggcaagctcgacgcggcc
atcaagtccgacctcggcggctacgacaagttccgcacggatttcatcgccgccggcacc
ggccagttcggctccggttgggcctggctgtcggtcaagaacggcaagctcgaaatctcc
aagaccccgaacggcgaaaacccgctggtgcacggcgcctcgccgatcctcggcgtcgac
gtctgggagcattcctactacatcgactaccgcaacgcccggccgaagtacctcgaggct
ttcgtcgacaatctcatcaactgggactacgtcctcgaaatgtacgaggcggcggtgaag
taa

DBGET integrated database retrieval system