Sinorhizobium fredii NGR234: NGR_c08920 Help Entry NGR_c08920        CDS       T00888                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rhi  Sinorhizobium fredii NGR234 Pathway rhi01100   Metabolic pathways rhi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rhi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NGR_c08920   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NGR_c08920 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N Delta_lysin Motif Other DBs NCBI-ProteinID:  ACP24682 UniProt:  C3M9B6 LinkDB All DBs Position 949400..949636 Genome browser AA seq 78 aa AA seqDB search MSDIAERVKKIVIDHLGVDAEKVSEGASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA DSILTVGDAVKFIEKAQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgcagaacgcgtgaagaaaattgttattgatcatcttggcgtcgatgcc gaaaaagttagcgaaggcgcaagcttcatcgacgacctcggcgcggactcgctcgacacg gtcgaactggtcatggctttcgaagaggaattcggcgtcgagattccggacgatgcggcg gattcgatcctcaccgtcggcgacgccgtcaagttcatcgaaaaggcccaggcctaa

DBGET integrated database retrieval system